KEGG   Saccharomyces cerevisiae (budding yeast): YOR018WHelp
Entry
YOR018W           CDS       T00005                                 

Gene name
ROD1, ART4
Definition
(RefSeq) Rod1p
  KO
K20062  arrestin-related trafficking adapter 4/5/7
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YOR018W (ROD1)
Membrane trafficking [BR:sce04131]
 Endocytosis
  Clathrin-mediated endocytosis
   GPCR adaptor proteins
    YOR018W (ROD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arrestin_C Arrestin_N LDB19
Motif
Other DBs
NCBI-GeneID: 854183
NCBI-ProteinID: NP_014661
SGD: S000005544
UniProt: Q02805
Position
XV:364369..366882
Genome map
AA seq 837 aa AA seqDB search
MFSSSSRPSKEPLLFDIRLRNLDNDVLLIKGPPDEASSVLLSGTIVLSITEPIQIKSLAL
RLFGRLRLNIPTVLQTVHGPHKRYSKFERNIYSHFWDDFNIKSYFQNLYDNHNNGKITIS
SKSSTNLAALPKRKRALSTASLISSNGQTSASKNYHTLVKGNYEFPFSAIIPGSLVESVE
GLPNAAVTYALEATIERPKQPDLICKKHLRVIRTLAIDAVELSETVSVDNSWPEKVDYTI
SIPTKAIAIGSSTMINILIVPILKGLKLGPVRISLVENSQYCGSYGGVINQERMVAKLKL
KDPLKHVAQIKKKRSLNEAADEGVDTDTGEFQDKWEVRALLNIPASLTKCSQDCRILSNI
KVRHKIKFTISLLNPDGHISELRAALPVQLFISPFVPVNVKTSDVIERTLKTFGPSYQVT
SQHDNSFSSKNFVDDSEEDVIFQRSASALQLSSMPTIVSGSTLNINSTDAEATAVADTTM
VTSLMVPPNYGNHVYDRVYGEVTNEDETSASASSSAVESQAIHNIQNLYISDSNNSNNPI
LAPNPQIKIEDDSLNNCDSRGDSVNNSNLNLVNSNLTISENWNNNSPSANRYNNIINAGL
NSPSLTPSFAHLSRRNSYSRQTSSTSLKNDLELTDLSRVPSYDKAMKSDMIGEDLPPAYP
EEELGVQENKKIELERPQILHHKSTSSLLPLPGSSKSSNNLKRSSSRTHLSHSPLPRNNS
GSSVSLQQLARNNTDSSFNLNLSFTSAKSSTGSRHFPFNMTTSFTSNSSSKNNSHFDKTD
STSDANKPREEENYTSATHNRRSRSSSVRSNNSNSPLRQGTGSFANLMEMFTKRDRS
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atgttttcatcatcatctcgaccttcaaaagagccattactatttgacatcagacttaga
aatttggacaatgatgttttactgataaaaggcccccctgatgaggcatcttctgtccta
ctatctggaactatagtattgtcaattactgagccaattcaaatcaagtctttggctttg
agactttttggtaggttgagactaaatattccaacggttttacaaactgttcatgggccg
cataagcgatactcaaagtttgagagaaacatatattctcatttttgggatgattttaat
ataaaaagttatttccaaaacttgtacgataatcataataatggtaaaataacaatttct
agtaaatcctcaacaaatttagcagcattgccaaagagaaaaagagccctttctactgca
tcattgatatcaagtaatgggcagacaagcgcaagcaaaaactatcacaccttagtaaaa
ggtaactacgaattccctttcagcgcgattattcctgggtcattagtggaaagtgtagaa
ggcctaccaaatgctgccgtcacttatgctctggaagctactatcgagagacctaagcag
cccgacttgatctgtaaaaaacatctaagagttattcgaacgttagctatagatgcagtc
gagttatctgaaacagtatcagtggataactcatggcctgaaaaagtcgattatacgatc
tccattccaactaaggcaattgccattggctcttccaccatgatcaatattttaattgtt
cctatattaaaaggattgaagttaggccctgttaggatcagtttggtggaaaattcccag
tattgtggtagctatggaggggttatcaaccaagaaagaatggtggctaaattaaaacta
aaagatcccctgaagcacgttgcccaaataaagaagaagaggagcctaaatgaagctgcc
gacgaaggggttgatacggacacaggggaatttcaagataaatgggaagttcgagcttta
ttaaacatacctgcaagcctgactaaatgctcccaagactgtcgcattttatctaatatc
aaagtccgtcataagatcaagttcactataagtttactcaatccggacggtcatatttca
gaattgcgtgcggcactgcctgtccaattattcatttcaccgtttgttccagtcaatgta
aagacctccgatgttattgaaagaacgctcaaaacgtttggaccctcatatcaagtaaca
agtcagcacgataattcattcagcagcaaaaactttgtagacgatagtgaagaagatgtg
atttttcaaagatctgcttctgcgttacaattgtcttcaatgccaaccatagtatctggc
tctactttaaatatcaatagtactgatgcagaggctaccgcagtcgctgacacaactatg
gtaactagtttgatggtacctcccaactacggcaatcacgtttacgatcgagtgtatggc
gaggtaactaatgaagacgaaacttcagcatcagcttcttcaagtgccgtcgaatcacag
gcaattcacaatattcaaaacctatatatatcggatagtaacaatagcaataatcctatt
ttggcaccaaatcctcaaatcaagattgaagatgatagcctaaataattgtgactctcga
ggggacagcgttaacaatagtaacctgaatctggttaatagtaatctaacaattagtgaa
aattggaacaataactctccttctgcaaatagatataataacatcattaatgctggattg
aatagtccttcactgacaccaagctttgcacatttatctaggcgtaactcatatagtcgc
caaacatcttctacatcgctgaagaacgatttggaactgacagatttaagcagagttccc
tcgtatgataaagcaatgaaatctgatatgattggtgaggatcttccaccggcttatccc
gaggaagaacttggagttcaagaaaataaaaaaattgaactagaaaggccacaaattctt
catcacaagtctacatcctctttgttgccacttccaggctcgagcaagagttccaataat
ctgaaaagatcgtctagtaggacacatttatcccactctccattaccaaggaataatagc
ggatcctcagtatcattgcagcagttggcgagaaacaacacagatagttcatttaatcta
aatctctctttcacttcagcaaaaagcagcacaggaagcagacattttccgtttaatatg
acaacatctttcactagtaattcaagttccaagaacaattcacattttgataaaactgat
tctacatctgacgctaataagccaagagaagaggaaaactatacgagcgcaacccacaat
cgaaggtcacgctcatcgtcagttcggagcaacaatagcaactcaccattaagacaagga
acaggttcatttgctaatttaatggagatgttcacaaaacgggatcgctcatag

DBGET integrated database retrieval system