KEGG   Saccharomyces cerevisiae (budding yeast): YOR020CHelp
Entry
YOR020C           CDS       T00005                                 

Gene name
HSP10, CPN10
Definition
(RefSeq) Hsp10p
  KO
K04078  chaperonin GroES
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:sce03110]
    YOR020C (HSP10)
   03029 Mitochondrial biogenesis [BR:sce03029]
    YOR020C (HSP10)
Chaperones and folding catalysts [BR:sce03110]
 Heat shock proteins
  HSP10
   YOR020C (HSP10)
Mitochondrial biogenesis [BR:sce03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    YOR020C (HSP10)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cpn10
Motif
Other DBs
NCBI-GeneID: 854185
NCBI-ProteinID: NP_014663
SGD: S000005546
UniProt: P38910
Position
XV:complement(370524..370844)
Genome map
AA seq 106 aa AA seqDB search
MSTLLKSAKSIVPLMDRVLVQRIKAQAKTASGLYLPEKNVEKLNQAEVVAVGPGFTDANG
NKVVPQVKVGDQVLIPQFGGSTIKLGNDDEVILFRDAEILAKIAKD
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atgtccacccttttgaagtctgctaaatctatcgttccattgatggaccgtgtccttgtc
caaagaatcaaggcacaagcaaagacagcatccgggttgtatttacctgaaaagaacgtg
gagaagttaaaccaagctgaagttgttgccgtaggcccgggctttactgatgctaatggt
aataaggttgttcctcaagttaaagttggtgaccaagttttgattccacagtttggtggt
tctaccattaaattgggtaacgacgatgaagttattcttttcagggacgctgaaatcctg
gctaagattgccaaggactaa

DBGET integrated database retrieval system