KEGG   Saccharomyces cerevisiae (budding yeast): YOR020W-AHelp
Entry
YOR020W-A         CDS       T00005                                 

Definition
(RefSeq) hypothetical protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP19
Motif
Other DBs
NCBI-GeneID: 1466480
NCBI-ProteinID: NP_878168
SGD: S000028526
UniProt: Q3E824
Position
XV:371685..371957
Genome map
AA seq 90 aa AA seqDB search
MGAAYKVFGKTVQPHVLAISTFIATAAVASYFTTKPKTKNEGKNSSALSQQKSGESSNSD
AMGKDDDVVKSIEGFLNDLEKDTRQDTKAN
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
atgggtgctgcatacaaagtatttgggaagacggttcaacctcacgtattggctatatct
acgtttatcgctactgctgcagtggcatcttactttaccacgaaaccaaaaaccaaaaat
gaaggcaagaatagttctgccttgagccaacaaaaaagcggtgaaagttcaaactcagat
gctatgggaaaggacgatgatgtcgtaaagagtattgaaggatttttaaatgatttagag
aaagatacgaggcaggatacgaaagccaactga

DBGET integrated database retrieval system