KEGG   Saccharomyces cerevisiae (budding yeast): YOR023CHelp
Entry
YOR023C           CDS       T00005                                 

Gene name
AHC1
Definition
(RefSeq) Ahc1p
  KO
K11370  ADA HAT complex component 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sce03036]
    YOR023C (AHC1)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    ADA-HAT complex
     YOR023C (AHC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3276
Motif
Other DBs
NCBI-GeneID: 854188
NCBI-ProteinID: NP_014666
SGD: S000005549
UniProt: Q12433
Position
XV:complement(376012..377712)
Genome map
AA seq 566 aa AA seqDB search
MMSPAQDKLQHQHHNPNSSSSSSSKMTNVYQVTTPKSPQDLENNMDEPFKMDTATSNPDK
DSENTQRLKYECAKGEIQNVLNLHIMLNHKHVRHLRRNVQKVNAKLALLETLHKDTGLLN
KIERTYQLKIKQHQQHSVLGGHFHDSTATENTNASNYNLSYPVLSDYNINCQPLSSSSNR
NLSTTRIPHHHYHTRSKSNGLLLEPSALRPANSNIIDYRLTGSKSLSEAITKPTPVSLPH
SNSDGISSPRSSSISPLDEQPGFQILPFKPSQMHLNHRRNYSSTCLTSNSGIIGKTENNE
PIFRRYDGILVIITCSKCDRSGFTSAQGIVNHTRLKHSKLYSSQPLAVLNNQKLLPNDKQ
DPEILSKFKKLNLDPNKDYLPSDIAIPKPQSPINHSENHTRAPKTVKNTPHLEKLYQNKE
DFKKLIDMVNETPDDLNEYLKQREIQLRYQKEQEEESSKSDDEASYVPSPSLSATATTTT
TTDPPSPPVLSSSLQRKLLRKRKLSLNSSTPMEDLPLRERLRANPTDKKPRKAALLTNEL
EGPDPAAKSSSYYNLRSKSRLRGSHT
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgatgagtcccgcccaagataaactgcagcaccagcatcataatcctaattcttcctca
tcgtcatcctctaagatgacgaacgtttatcaggttaccacgccaaagtctcctcaggat
ttggaaaacaacatggatgagcccttcaaaatggacaccgccaccagtaatccggacaag
gatagcgaaaatacccagcggttgaagtacgaatgtgccaaaggggaaatacagaatgtt
ttgaacctacatataatgctaaaccacaagcatgttaggcacttacgaagaaatgttcaa
aaggttaacgcaaaactagctctcttggaaaccctgcataaggatactggtctattgaac
aaaatcgaacggacgtatcaactcaaaataaaacaacatcagcagcatagcgtgctcggc
ggccactttcacgacagtacggctacggaaaatacgaacgcatcaaattataacctgtca
tacccggttctatcggattataacatcaactgtcagcctttgtcttcgagcagcaacaga
aatctgtcaacaacacgcataccacaccaccattatcatactagaagcaagagtaacggg
cttttgctagaaccttctgccctccgtccggcaaattcgaatataattgattacaggcta
acaggttctaaatctctatcagaagccataaccaagcccactcccgtctcgcttcctcac
tctaattcggatggcatttcttcacctcgttcctcctcaatctcccccttagacgagcag
ccggggttccagatactcccttttaaaccaagtcagatgcatcttaaccacagacgtaat
tacagtagcacttgtttgacgagcaatagcggtatcatcggtaagactgaaaataatgag
cccatttttagaagatatgacggcattttggttataattacgtgctccaaatgtgaccgt
tccggtttcacttccgcgcaaggtatcgtgaaccatactcgactaaaacattctaaacta
tattcaagccaaccattggcagttttaaacaaccaaaaactacttcctaatgataagcag
gatccggaaattttatctaagttcaagaaactaaatttggacccaaacaaagactaccta
ccctctgacattgcaatcccaaaaccacaatcaccaatcaaccactccgagaaccatacg
cgggctccaaagactgtcaagaacactcctcatttagaaaaactataccaaaataaagaa
gacttcaaaaaactgattgacatggttaatgaaactccggatgatttgaatgaatatttg
aagcaacgtgaaattcaattaagatatcaaaaggagcaagaagaggaatcttccaaatct
gatgacgaagcttcttacgtcccatcaccgtctctctcagcaacggctacaacaacaacg
actacggacccaccctctccgccagtgctatcctcctccttacaaagaaaattgctgcgt
aagagaaaactgagcttgaatagctctactcccatggaagatttacctttaagagaaagg
ttgagagcaaatcccactgacaagaaaccaagaaaagcggcccttttgactaatgaactt
gagggtcctgatcctgcagcaaaatcatcatcttattacaatctaaggtcgaaatcaaga
ctgcgtggttctcatacatag

DBGET integrated database retrieval system