KEGG   Saccharomyces cerevisiae (budding yeast): YOR033CHelp
Entry
YOR033C           CDS       T00005                                 

Gene name
EXO1, DHS1
Definition
(RefSeq) Rad2 family nuclease EXO1
  KO
K10746  exonuclease 1 [EC:3.1.-.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    YOR033C (EXO1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YOR033C (EXO1)
   03400 DNA repair and recombination proteins [BR:sce03400]
    YOR033C (EXO1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     YOR033C (EXO1)
DNA replication proteins [BR:sce03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    YOR033C (EXO1)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    Other MMR factors
     YOR033C (EXO1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: XPG_N XPG_I 5_3_exonuc HHH_2 XPG_I_2 TPR_8 DUF1825
Motif
Other DBs
NCBI-GeneID: 854198
NCBI-ProteinID: NP_014676
SGD: S000005559
UniProt: P39875
Position
XV:complement(392416..394524)
Genome map
AA seq 702 aa AA seqDB search
MGIQGLLPQLKPIQNPVSLRRYEGEVLAIDGYAWLHRAACSCAYELAMGKPTDKYLQFFI
KRFSLLKTFKVEPYLVFDGDAIPVKKSTESKRRDKRKENKAIAERLWACGEKKNAMDYFQ
KCVDITPEMAKCIICYCKLNGIRYIVAPFEADSQMVYLEQKNIVQGIISEDSDLLVFGCR
RLITKLNDYGECLEICRDNFIKLPKKFPLGSLTNEEIITMVCLSGCDYTNGIPKVGLITA
MKLVRRFNTIERIILSIQREGKLMIPDTYINEYEAAVLAFQFQRVFCPIRKKIVSLNEIP
LYLKDTESKRKRLYACIGFVIHRETQKKQIVHFDDDIDHHLHLKIAQGDLNPYDFHQPLA
NREHKLQLASKSNIEFGKTNTTNSEAKVKPIESFFQKMTKLDHNPKVANNIHSLRQAEDK
LTMAIKRRKLSNANVVQETLKDTRSKFFNKPSMTVVENFKEKGDSIQDFKEDTNSQSLEE
PVSESQLSTQIPSSFITTNLEDDDNLSEEVSEVVSDIEEDRKNSEGKTIGNEIYNTDDDG
DGDTSEDYSETAESRVPTSSTTSFPGSSQRSISGCTKVLQKFRYSSSFSGVNANRQPLFP
RHVNQKSRGMVYVNQNRDDDCDDNDGKNQITQRPSLRKSLIGARSQRIVIDMKSVDERKS
FNSSPILHEESKKRDIETTKSSQARPAVRSISLLSQFVYKGK
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgggtatccaaggtcttcttcctcagttaaagcccatacagaatccagtatcactacgt
aggtatgaaggagaagtgttagccattgatggctatgcatggctacatagagcagcctgc
tcttgtgcttatgaacttgcaatgggaaaaccaactgataagtacctgcagtttttcata
aaaagatttagtttattgaaaacctttaaagttgaaccgtatttggtcttcgatggtgat
gccattccagttaaaaagtctactgaatctaaaagaagggataagagaaaagaaaacaaa
gccatagctgaaagactgtgggcctgtggcgaaaagaaaaatgctatggactattttcaa
aaatgtgtcgacataacgcctgaaatggcaaaatgtatcatatgctactgtaagctaaac
ggtattcggtacatagtggctccgtttgaggctgactctcaaatggtatatttagaacag
aaaaacattgtgcaaggaataatatccgaagattctgacctcctcgtcttcggatgtcga
cgtctcattacgaagctgaatgattatggagaatgtttagaaatatgtcgcgataatttt
attaaactgcctaaaaagtttccgttgggatccttaactaatgaagaaatcataacaatg
gtttgtttatccggttgtgactatacaaatggaattcccaaggttggcctgattaccgca
atgaaattagttagaagattcaatactattgaaaggataattctgagtatacagcgggag
ggaaaactgatgataccagacacatacattaatgaatatgaagctgcagttttagcattt
caattccaaagggtattttgccctattcggaagaaaatagtgagcttgaatgaaattccg
ctgtacttgaaagataccgaaagtaaaagaaaaagactctacgcgtgcattggttttgtc
atacacagagaaactcagaaaaagcaaattgttcatttcgacgacgatatagatcaccac
ttgcatttaaaaattgctcaaggtgacttgaatccatatgattttcaccaacctctagcc
aacagagagcacaaattacagctggcatccaagtcaaatatagagttcgggaaaactaat
actactaattctgaagccaaagtcaaaccaatagaatcgttcttccaaaaaatgacaaaa
ttggatcataacccaaaagttgcaaataacatccatagtctaagacaagcggaagacaaa
ctgacaatggcaattaagcgtaggaaattaagtaatgccaatgtagtccaagaaacgttg
aaggatacaagaagcaaattttttaataaaccctccatgactgttgtggaaaacttcaaa
gaaaaaggcgacagcatacaggattttaaagaggacacaaactcacaatctttggaagag
cctgtttccgagtctcaactatctacacaaatacctagttcttttattacaaccaattta
gaggatgacgacaacctgagtgaagaggtttctgaagttgtcagtgacattgaagaggac
cgaaagaattctgaaggaaagactatcggtaacgaaatctataatacagatgatgacggt
gatggcgatactagcgaggattatagcgaaactgcggaatcaagagttcccacgagcagc
accacctcatttcccgggtcatcccagaggagtatatcggggtgcacaaaagttttacaa
aagtttagatattcatcttcattcagcggagttaatgcaaatagacaaccactatttcct
cggcacgttaatcaaaaaagtagaggaatggtatacgtcaatcaaaatagagatgatgat
tgcgacgataacgatggtaaaaatcaaatcacgcaaaggccatcactgcgaaaaagcctt
attggtgccaggtcacagagaattgtgattgacatgaaaagcgtagatgaacgaaaatca
ttcaattcatcaccaattttgcatgaggaaagtaagaaaagggacatcgaaactactaag
tcaagccaagctcggccggcagtcagatctatctccttgctttcccaatttgtttataaa
ggtaaataa

DBGET integrated database retrieval system