KEGG   Saccharomyces cerevisiae (budding yeast): YOR036WHelp
Entry
YOR036W           CDS       T00005                                 

Gene name
PEP12, VPL6, VPS6, VPT13
Definition
(RefSeq) SNAP receptor PEP12
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Syntaxin_2 SNARE Syntaxin CdvA BLOC1_2 Synaptobrevin CEP209_CC5 FAM76
Motif
Other DBs
NCBI-GeneID: 854201
NCBI-ProteinID: NP_014679
SGD: S000005562
UniProt: P32854
Structure
PDB: 

Position
XV:400348..401214
Genome map
AA seq 288 aa AA seqDB search
MSEDEFFGGDNEAVWNGSRFSDSPEFQTLKEEVAAELFEINGQISTLQQFTATLKSFIDR
GDVSAKVVERINKRSVAKIEEIGGLIKKVNTSVKKMDAIEEASLDKTQIIAREKLVRDVS
YSFQEFQGIQRQFTQVMKQVNERAKESLEASEMANDAALLDEEQRQNSSKSTRIPGSQIV
IERDPINNEEFAYQQNLIEQRDQEISNIERGITELNEVFKDLGSVVQQQGVLVDNIEANI
YTTSDNTQLASDELRKAMRYQKRTSRWRVYLLIVLLVMLLFIFLIMKL
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaagacgaattttttggtggtgataatgaagccgtttggaacggttccagattc
agtgattcacctgagttccaaacgttgaaagaagaggttgctgcagagttatttgaaata
aatgggcaaataagcacgctgcagcagtttaccgcgacacttaagtcatttatagatcgg
ggagatgttagtgcgaaagttgtggaaagaattaataagagatctgtggcaaagatagaa
gaaataggcgggctcattaaaaaggtcaatacatcagtgaaaaagatggatgcgattgag
gaagctagcctggataagactcaaataatagcgagagagaaacttgtgagggatgtcagt
tactcttttcaagagtttcaaggtattcagcggcagtttacccaagtaatgaaacaagtt
aatgaaagagcaaaagaatctcttgaagcaagtgagatggcaaatgatgctgctttatta
gatgaagaacaaaggcagaatagctcaaaaagtactcgaataccaggcagccaaatagtc
attgagagagacccgataaataacgaagagtttgcttatcagcaaaatcttatcgagcaa
agagaccaggaaatcagcaatattgaaagaggtataacggaactgaacgaagtttttaaa
gatttgggaagtgttgttcaacagcagggtgtgctagttgacaatattgaagcaaatatt
tatacaacgtcagataacactcaattggcttcagacgagctaaggaaggccatgcggtac
caaaaacgtacgagcagatggagggtgtatttgttgattgtgcttctcgtaatgcttctt
tttatttttctcattatgaaattgtaa

DBGET integrated database retrieval system