KEGG   Saccharomyces cerevisiae (budding yeast): YOR038CHelp
Entry
YOR038C           CDS       T00005                                 

Gene name
HIR2, SPT1
Definition
(RefSeq) Hir2p
  KO
K11293  protein HIRA/HIR1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sce03036]
    YOR038C (HIR2)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histone chaperones
    Other Histone chaperones and regulators
     YOR038C (HIR2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hira DegV
Motif
Other DBs
NCBI-GeneID: 854203
NCBI-ProteinID: NP_014681
SGD: S000005564
UniProt: P32480
Position
XV:complement(402761..405388)
Genome map
AA seq 875 aa AA seqDB search
MRLLKYPLDIHNEQVNALAALGPYIILAGSGGHVMAWRQQQLVDTAFDRVMIKDLKPEVS
FQVDQDTTGDIFFITGDLETLYIGSEHRLWGYSGWLCRDTNNINSVEKMNSKLLFECKSP
STITDVKYDINLGILFVLLSNENKILLFRHKTFDKLSEITIDKASKPITGIIDPTGQTFT
VMTSDRSILVYQINKTGTHKLINKLTQHVQMYPLHYRISMSPQADILPVINSVKGVPNNA
TSCTALLDRNNNYKVTKTLVTPSSNGCRVLVYSPAFYEKPNLKKGTSTRYNLIATSGSTD
GTILVWNTKRMKPLFNALQVSSTAINDMSWSQDGFTLFAISNDATLYTFAFQEKDLGVAL
PQTEIKSLQEVNKKLPKLEEPLAEQIPKSFPENIKLEESASAAPIPNDIGRSAVGKKPTK
KKTANNQTNGIKTIQSTSMEFNTPSYTVPRDLKRKPKEATPSNIAPGSKKQKKELQPIDF
LDTGLLLPNTSFSRIRLATPKIRSTFKYSPINNPNLILDVKNGSGNEQRPTIVKLTSKVL
DQDQVLFQDFIPKLITICTAGDTFWSFCSEDGSIYIYSDSGRKLMAPLVLGVSISFLEAC
GTYLLCLTSIGELYCWNIEQKKLAFPTNTIYPLLNPSLRYSDDILTRAENITLCSITKKG
VPLVTLSNGDGYLFDKNMETWLLVSDGWWAYGSQYWDTTNTTGLSSSKANTDSFNGSESN
INEIVSDIKNDNQSIINFLECKTNDELNRKGRIKNLQRFARTILMKEGFENMEEIVTLSH
LENKILISIRLEEPEEFSKLMMVYCIRLSELGYMDRLNDVFQWLYDDLPISGTGSAFADK
DFKRNLLKKILIACGDIRQVQRVTTRYAKEMNIIS
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
atgagattattaaagtatcctttggatattcataatgaacaagtgaatgccttagctgcc
cttggtccctatatcatattggcaggcagtgggggtcacgtgatggcgtggagacaacaa
caactagtcgatactgcattcgatagggttatgattaaggatttaaagccagaagtttct
ttccaggtggatcaggatactaccggtgatatttttttcataacaggtgatctcgaaaca
ttgtatattggatctgaacatcgtctgtggggttattcaggttggctctgtagagataca
aataacatcaattctgtcgaaaaaatgaacagtaagcttctgttcgagtgtaaatctcca
agcacaataacggatgtgaaatatgacataaacttaggtatcttatttgttcttttaagt
aatgaaaataagatactattatttcggcataaaacctttgataaactctctgaaataact
attgacaaggcgagcaaacctattacaggcataatagatcctactggccaaacttttact
gttatgacttcagatagatcaattttagtctatcaaattaacaaaacgggtacacacaaa
ctcataaataaacttacgcagcatgtacaaatgtatccattacattatagaatctcaatg
tcacctcaggcagacattttaccagtgataaactcggtgaaaggtgtgccgaataatgct
accagctgtaccgctttacttgacagaaataacaactacaaagttacaaaaacactggta
acaccttcttcaaatggatgtagagttcttgtttattctccagcattttatgaaaagcct
aatttgaaaaagggcaccagcacacgctataatttaatcgccacttcgggatctacagac
ggtactattttggtttggaatacgaagagaatgaaacctttgtttaatgctctccaggtt
tcctccaccgcaataaacgatatgtcttggtcacaggatgggttcaccttgtttgccatt
tcaaacgacgcgacattgtatacattcgcattccaagagaaggatttaggtgtagcattg
cctcaaacggaaatcaaatcgttacaagaagtaaacaaaaagcttccaaagcttgaagag
ccgttagcagaacaaataccgaaaagtttcccagaaaacatcaaattagaagaatctgca
agcgcagcacctattccaaacgatattggtagatctgccgtgggcaagaaaccgaccaaa
aaaaaaacggctaacaatcaaactaatggcatcaaaactatccagagcacatcaatggaa
ttcaacactccatcatacactgtgccaagggatttgaagagaaagccaaaagaggcaact
ccaagtaacattgcccctggcagcaaaaagcagaaaaaagagctacagccaattgacttt
ttagataccggcttgctcctacccaatacgtctttctcaaggattagacttgcaacaccg
aaaatcagatctacatttaaatactctccaattaataatccgaatttaatcctcgatgtt
aagaatggatctggcaatgaacaaaggccgacaattgtcaagcttacctcaaaagttctc
gatcaagatcaagttctatttcaagattttattccaaaactcataacaatctgcacagca
ggtgacaccttttggtcattctgtagtgaggacggaagtatttacatatattctgattcg
ggtagaaaactaatggctcccctagtattaggagttagcattagtttccttgaagcatgt
ggaacttatttactttgcttaacaagcataggggagctttattgttggaacatagagcag
aagaagctggcttttcccaccaacactatttatccattgttaaacccgtcattgcgatac
tcagatgatatattgaccagagctgaaaatataacattgtgctctattacaaaaaagggt
gtgccactagttacactgagtaatggcgatggttatttgttcgataagaacatggaaaca
tggcttctggtaagcgatgggtggtgggcctatggttcgcagtactgggacactactaat
actactgggttgtcttctagcaaagcaaataccgactcttttaatggcagtgaatctaat
attaatgaaatagttagtgatatcaagaatgataatcaaagtatcattaactttttggaa
tgcaaaacgaatgacgaacttaatagaaagggtaggattaagaatttacagagatttgct
aggacaatattaatgaaagagggatttgaaaatatggaggagatcgtaactttgtctcac
ctggaaaataaaatcctaataagtatcagattggaggagcctgaagagttttcgaagcta
atgatggtttattgcatccgtctgagtgaattggggtatatggaccgtttgaacgatgtt
tttcaatggttatatgatgatctccccatcagtggtaccgggtcagcatttgccgataaa
gattttaagaggaaccttctaaaaaagatactaattgcatgcggtgatatcagacaggtt
caaagagttactacacgttatgccaaggaaatgaatataatatcttag

DBGET integrated database retrieval system