KEGG   Saccharomyces cerevisiae (budding yeast): YOR056C
Entry
YOR056C           CDS       T00005                                 
Symbol
NOB1, YOR29-07
Name
(RefSeq) rRNA-binding endoribonuclease
  KO
K11883  RNA-binding protein NOB1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    YOR056C (NOB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sce03009]
    YOR056C (NOB1)
   03051 Proteasome [BR:sce03051]
    YOR056C (NOB1)
Ribosome biogenesis [BR:sce03009]
 Eukaryotic type
  Pre-40S particles
   Export and cytoplasmic maturation factors
    YOR056C (NOB1)
Proteasome [BR:sce03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    YOR056C (NOB1)
SSDB
Motif
Pfam: PIN_6 NOB1_Zn_bind LolA_3
Other DBs
NCBI-GeneID: 854221
NCBI-ProteinID: NP_014699
SGD: S000005582
UniProt: Q08444
Structure
Position
XV:complement(430247..431626)
AA seq 459 aa
MTENQTAHVRALILDATPLITQSYTHYQNYAQSFYTTPTVFQEIKDAQARKNLEIWQSLG
TLKLVHPSENSIAKVSTFAKLTGDYSVLSANDLHILALTYELEIKLNNGDWRLRKKPGDA
LDASKADVGTDGKQKLTEDNKKEEDSESVPKKKNKRRGGKKQKAKREAREAREAENANLE
LESKAEEHVEEAGSKEQICNDENIKESSDLNEVFEDADDDGDWITPENLTEAIIKDSGED
TTGSLGVEASEEDRHVALNRPENQVALATGDFAVQNVALQMNLNLMNFMSGLKIKRIRNY
MLRCHACFKIFPLPKDGKPKHFCASCGGQGTLLRCAVSVDSRTGNVTPHLKSNFQWNNRG
NRYSVASPLSKNSQKRYGKKGHVHSKPQENVILREDQKEYEKVIKQEEWTRRHNEKILNN
WIGGGSADNYISPFAITGLKQHNVRIGKGRYVNSSKRRS
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgaccgaaaaccaaaccgcacatgtaagggcgttgatattggatgccaccccattaatt
acgcagtcctacacacattaccagaattatgcacagtctttttatactactcccacagtt
tttcaagaaattaaggatgctcaagcaaggaaaaaccttgaaatttggcagagcctcgga
actttgaaattagtacatccaagtgaaaactcgatagccaaagtaagtacgttcgccaaa
ttgaccggtgactactccgtactgagtgccaatgatttgcatattcttgctttgacatac
gagttagaaattaaactaaataatggcgattggagactgaggaaaaaaccaggtgatgca
ttagatgcgtccaaggctgacgttggtacggacggcaaacagaagctcacagaagataat
aaaaaggaggaggactctgaaagtgttccaaaaaaaaagaacaagagaagaggtggaaaa
aagcaaaaggcaaaaagagaagcaagagaagcaagagaagctgaaaatgcaaaccttgag
ctagagagtaaagctgaggaacatgttgaggaggctggatccaaagagcagatatgtaat
gatgaaaatataaaggaatcttccgatttaaatgaagtattcgaggatgctgatgatgat
ggtgattggattacccccgagaacttaacagaagcaattattaaggatagtggtgaagat
accactggttcattgggtgtagaagcgtccgaagaggatcgccatgtcgcattgaatcga
ccagagaatcaggtggcattggcgactggcgattttgccgtccaaaatgtagcgttgcag
atgaatctaaatctaatgaatttcatgtcaggtctgaaaatcaagcgaatccgtaattat
atgctaagatgccacgcctgtttcaaaatatttcctctaccaaaagacggcaagccaaag
cacttctgtgcctcatgcggtggacagggtaccttattaagatgcgcagtttccgttgac
tcacgcacggggaacgttacaccgcacttgaagtcgaacttccaatggaacaatagagga
aacagatattctgtagccagccccttatctaagaactcccaaaaaaggtacggcaaaaag
ggacacgtacattctaaaccacaggaaaatgtgattctcagagaagatcaaaaggagtac
gaaaaggtgataaagcaagaagaatggacaagaagacacaacgagaagattctaaacaat
tggattggtggcggttctgcggataactatatttctccatttgcaattactgggttgaag
cagcataacgtccgcattggtaagggaaggtacgtcaacagttccaaaaggagaagttag

DBGET integrated database retrieval system