KEGG   Saccharomyces cerevisiae (budding yeast): YOR057WHelp
Entry
YOR057W           CDS       T00005                                 

Gene name
SGT1
Definition
(RefSeq) co-chaperone SGT1
  KO
K12795  suppressor of G2 allele of SKP1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SGS CS ANAPC3
Motif
Other DBs
NCBI-GeneID: 854222
NCBI-ProteinID: NP_014700
SGD: S000005583
UniProt: Q08446
Structure
PDB: 

Position
XV:432186..433373
Genome map
AA seq 395 aa AA seqDB search
MPVEKDLKTAYKALYDEKEPLKALHLYDEILKGSPTNLTALIFKAACLEKLYFGFSDWHS
DATMENAKELLDKALMTAEGRGDRSKIGLVNFRYFVHFFNIKDYELAQSYFKKAKNLGYV
DDTLPLWEDRLETKLNKKNKKQKDSTNKHTIKPVESIENRGDNNSSHSPISPLKIETAPQ
ESPKFKIDWYQSSTSVTISLFTVNLPESKEQVNIYISPNDRRTLSISYQVPKSGSEFQYN
AKLSHEVDPKAVSLKIFPKKLEITLSKIDSTQWKKLEEDILTESSRLSDEGKNSDSATRL
LSAETASKERLSYPSSSKKKIDWSKLDIDEEADEEAGSADSFFQKLYAGADPDTKRAMMK
SFIESNGTALSTDWEDVSKGTVKTSPPEGMEPKHW
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgcctgttgaaaaagatttaaaaactgcctacaaagctttgtatgatgagaaggaacca
ctgaaggccctccatctttatgatgaaattctcaaaggctcacccacaaatttaacggct
ctcatttttaaggcagcatgtcttgaaaagctatactttgggttttctgattggcacagc
gatgcaactatggaaaacgcaaaggaacttcttgacaaggctctaatgacagctgagggt
aggggcgatagatcgaagattggtcttgttaactttcgttattttgttcatttcttcaat
atcaaagattatgaactggcccaatcttattttaaaaaagccaagaatcttggttacgtt
gatgacactttgcctttatgggaagatcgtctggagacaaaattgaataaaaaaaataaa
aagcagaaggattcaactaataagcatacaattaaaccagtggaaagtattgaaaacaga
ggagataataattcttctcatagtcccatttcacctctcaaaattgaaaccgctcctcaa
gaatcccctaaatttaaaatcgattggtatcaatccagcacctctgtcactatatcatta
tttactgttaatcttcctgagtctaaggaacaagtcaatatatatatttctccaaacgat
agaagaactttatcgatatcgtaccaagtaccgaaatctggatctgaatttcaatacaac
gctaagctttcgcatgaggtggatccaaaagcagtgtcattaaaaattttcccaaaaaag
ctggaaattaccttgagcaaaattgatagcacgcaatggaagaagttggaagaagatatt
ttaacggaatcctcaaggttatcagatgagggtaaaaattctgattctgcaacccgctta
ttatcagcagaaacggcatcaaaagagagattgtcttatccatcgtcctctaaaaaaaaa
atagattggtctaaacttgacattgatgaagaagctgatgaagaagcgggatcggctgat
agtttctttcaaaagctttacgctggagcggatccagataccaaaagggctatgatgaaa
tcctttatagaaagtaatggtactgcattgagtacagactgggaagacgtatctaaggga
acggttaaaacttcaccaccagaaggcatggaacctaaacattggtaa

DBGET integrated database retrieval system