KEGG   Saccharomyces cerevisiae (budding yeast): YOR071C
Entry
YOR071C           CDS       T00005                                 

Gene name
NRT1, THI71, YOR29-22
Definition
(RefSeq) nicotinamide riboside transporter
  KO
K03457  nucleobase:cation symporter-1, NCS1 family
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    YOR071C (NRT1)
Motif
Pfam: Transp_cyt_pur SPC25
Other DBs
NCBI-GeneID: 854237
NCBI-ProteinID: NP_014714
SGD: S000005597
UniProt: Q08485
Position
XV:complement(459480..461276)
AA seq 598 aa
MSFSSIVSKFLRYLEIPAKNRTAVNFLRNPDLQPIKSANQTWGFWSNLAYWGAVSFTAGT
WMSGSAALSVGLSYPETIVSFLLGNVLTIIFTMANSYPGYDWKIGFTLAQRFVFGIYGSA
FGIIIRILMSIVNYGSNAWLGGLSINMILDSWSHHYLHLPNTLSPSVAMTTKQLVGFIIF
HVLTALCYFMKPYHMNYLLIWSCVATCFAMLGIVIYLTKNAHGVGELFTSTKSTVTGSKR
AWAWVYMISYWFGSISPGSTNQSDYSRFGSSNLAIWTGSVCALLIPATLVPIFGVISAST
CDKLYGKQFWMPMDIFDYWLTNNYSAGARAGAFFCGLCFTMSQMSSTISNCGFATGMDMA
GLLPKYVDIKRGALFCACISWACLPWNFYNSSSTFLTVMSSFGVVMTPIIAVMICDNFLI
RKRQYSITNAFILKGEYYFTKGVNWRAIVAWVCGMAPGLPGIAWEVNNNYFHDSGIVKFF
YGDSFFSFLISFFVYWGLCVFFPFKITVRHDDKDYYGAFTDEEARKKGMIPYSEISEEEI
RAYTLGECYTTGHEYKPESSDNESPELIKTSSENTNVFEIVHQKDDEKHSFSTTQQVV
NT seq 1797 nt   +upstreamnt  +downstreamnt
atgagcttcagtagtatagtctctaagtttttgagatatttagaaattcctgccaaaaat
aggactgccgtgaattttctgaggaaccctgatttgcaacctatcaagtctgcaaatcaa
acatgggggttctggtctaatttggcgtactggggcgctgtgtcctttacagcaggtaca
tggatgagtggttctgctgcactaagtgtcggcctaagttacccagagaccattgtttcg
tttcttctcggtaatgtcttgaccattattttcactatggccaactcttaccccggttat
gattggaaaatcggtttcaccttggcccaaagattcgtttttggcatttacggttcagcc
ttcggtatcatcattagaattttgatgagtattgtcaattatggttccaacgcttggttg
ggtggtctatctatcaacatgatattagattcctggtcccaccactatctgcacctgccc
aatactttgtccccaagtgttgccatgaccaccaagcagttggtcggcttcattattttc
cacgtcctcaccgcgctctgctatttcatgaaaccctaccatatgaactaccttttaatt
tggtcatgtgtagctacttgctttgccatgctgggtatagtgatttacttgactaagaat
gcccatggtgtcggtgaattgtttacctccacaaaatctaccgttactggttctaaaaga
gcatgggcttgggtttacatgatttcatactggttcggttccatttctccaggttccacc
aaccaaagtgactattcaagattcggttcctccaatttggctatctggaccggtagcgtc
tgtgcattactaatcccagcaaccttggtcccaatcttcggtgtcattagtgcctccacc
tgcgacaaattatacggtaaacaattttggatgcccatggatatattcgattattggttg
acaaacaactattctgcaggcgctcgcgcaggtgccttcttctgtggtctttgctttacc
atgtctcaaatgtcctccaccatctccaactgtgggtttgccactggtatggatatggcc
ggtttgttgcccaaatacgtcgatatcaagagaggtgctcttttttgcgcatgtatctcc
tgggcttgtttgccatggaacttctacaactcttcttctactttcttaactgtcatgagt
tctttcggtgttgtcatgactcctattattgctgtcatgatctgtgataactttctgatc
aggaagaggcaatattccattactaatgcctttattctaaagggtgaatactattttacc
aagggtgtcaactggagagctatcgttgcctgggtgtgtggtatggctcccggtctacct
ggtatcgcttgggaagtcaacaataactatttccacgactcaggtattgttaaattcttt
tatggtgattctttcttctcctttttgatttcttttttcgtttactgggggctatgtgtc
ttcttcccattcaaaattactgttagacatgatgacaaagattactatggtgcatttacc
gacgaagaagcgagaaagaagggcatgattccatacagtgaaatttctgaggaagaaatc
cgtgcttacacgttaggcgaatgctacacaactggacacgaatacaaacctgagagttct
gataacgaatcacctgaattgatcaaaactagctcagaaaacactaacgtatttgaaatc
gttcaccaaaaggatgatgaaaagcactcctttagtaccactcaacaagttgtctga

DBGET integrated database retrieval system