KEGG   Saccharomyces cerevisiae (budding yeast): YOR099W
Entry
YOR099W           CDS       T00005                                 

Gene name
KTR1
Definition
(RefSeq) alpha-1,2-mannosyltransferase KTR1
  KO
K10967  alpha 1,2-mannosyltransferase [EC:2.4.1.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    YOR099W (KTR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sce01003]
    YOR099W (KTR1)
Enzymes [BR:sce01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     YOR099W (KTR1)
Glycosyltransferases [BR:sce01003]
 Glycan extension
  Yeast mannan chain
   YOR099W (KTR1)
SSDB
Motif
Pfam: Glyco_transf_15 DUF5874 CagE_TrbE_VirB
Other DBs
NCBI-GeneID: 854266
NCBI-ProteinID: NP_014742
SGD: S000005625
UniProt: P27810
Position
XV:511825..513006
AA seq 393 aa
MAKIMIPASKQPVYKKLGLLLVAVFTVYVFFHGAQYARGSAPSPKYSTVLSSGSGYKYSK
VELPKYTGPREKATFVTLVRNRDLYSLAESIKSVEDRFNSKFNYDWVFLNDEEFTDEFKN
VTSALVSGTTKYGVIPKEHWSFPEWIDEEKAAQVRKEMGEKRIIYGDSISYRHMCRFESG
FFYRHPLMDDYDWYWRVEPDIKLHCDIDYDVFKFMKDNKKKYAFAISIKEYEATIPTLWE
TTRKFMEAHPELIHENNMLDFVSDDQGLSYNLCHFWSNFEIAALDLWRSPAYSAYFDYLD
REGGFFYERWGDAPVHSIGAALFLDRSEIHHFGDIGYYHVPFHSCPIDTSIRLANKCDCD
PSKDFTWHSYSCTTKFYNINKLPKPAGWQNHIG
NT seq 1182 nt   +upstreamnt  +downstreamnt
atggcgaagattatgatcccagctagcaagcagcctgtttacaaaaaattaggacttctt
ctggtcgccgtgtttactgtgtatgtgttctttcatggagctcagtatgcgagaggctct
gccccaagcccaaagtacagtaccgtgctatcttccggctcgggctataaatactcgaaa
gtggaactaccaaagtataccggtcctcgggaaaaggccacttttgtcactctagtgcgt
aatagagatctatattcgttggctgagtctattaaatccgtggaagatagatttaactcc
aagttcaactatgattgggtgtttttgaatgatgaagagttcactgatgaattcaaaaac
gttacgtcagctttagttagtggtacaacaaaatacggtgtcatcccaaaggaacattgg
tccttccctgagtggattgatgaagaaaaggccgctcaagtcaggaaggagatgggtgag
aagagaatcatctacggtgattctatctcttacagacacatgtgtcgttttgaatcaggc
ttcttttacagacatcctttgatggatgactacgattggtattggcgtgtggaacctgat
atcaagttgcactgtgatatcgactacgatgtcttcaaattcatgaaagacaataagaaa
aagtatgcctttgccatttccattaaggagtatgaagctactatccccactttatgggag
actactcgtaaattcatggaagcccatcctgagcttatccatgaaaataatatgttagac
tttgttagcgacgatcagggactttcatacaatttgtgccatttttggtctaattttgaa
attgctgctttggatttgtggagatctccagcatactccgcatattttgattatttagat
cgtgaaggtggattcttttatgaaagatggggtgatgctccagttcattctattggtgct
gcgctgttcttggaccgctctgaaatccatcacttcggtgatattggttattaccatgtt
ccatttcactcctgtccaatagacacaagtatcagactggctaacaaatgtgactgtgat
ccaagcaaagatttcacatggcacagttattcatgtactactaaattctacaatataaac
aagttgccaaagcctgctggttggcaaaaccatatcggttga

DBGET integrated database retrieval system