KEGG   Saccharomyces cerevisiae (budding yeast): YOR100C
Entry
YOR100C           CDS       T00005                                 

Gene name
CRC1
Definition
(RefSeq) carnitine:acyl carnitine antiporter
  KO
K15109  solute carrier family 25 (mitochondrial carnitine/acylcarnitine transporter), member 20/29
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YOR100C (CRC1)
Transporters [BR:sce02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   YOR100C (CRC1)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 854267
NCBI-ProteinID: NP_014743
SGD: S000005626
UniProt: Q12289
Position
XV:complement(513295..514278)
AA seq 327 aa
MSSDTSLSESSLLKEESGSLTKSRPPIKSNPVRENIKSFVAGGVGGVCAVFTGHPFDLIK
VRCQNGQANSTVHAITNIIKEAKTQVKGTLFTNSVKGFYKGVIPPLLGVTPIFAVSFWGY
DVGKKLVTFNNKQGGSNELTMGQMAAAGFISAIPTTLVTAPTERVKVVLQTSSKGSFIQA
AKTIVKEGGIASLFKGSLATLARDGPGSALYFASYEISKNYLNSRQPRQDAGKDEPVNIL
NVCLAGGIAGMSMWLAVFPIDTIKTKLQASSTRQNMLSATKEIYLQRGGIKGFFPGLGPA
LLRSFPANAATFLGVEMTHSLFKKYGI
NT seq 984 nt   +upstreamnt  +downstreamnt
atgtcttcagacacttcattatcagaatcttcattattgaaagaagagagtgggagcttg
accaagtctcgtccacctataaaatcaaaccctgtacgcgaaaatatcaaatcatttgtg
gccggtggagttggcggggtatgtgcggtgtttacgggtcatcccttcgatttgattaaa
gtgagatgtcaaaatggacaagcgaattccacggtacatgccattacaaatattataaaa
gaagcaaaaactcaagtaaagggcacattatttaccaattccgtaaaggggttctataaa
ggtgttatcccgcccttattaggtgttactcccatattcgctgtttctttctggggttac
gatgtgggtaagaaactggttacttttaataacaagcaaggaggcagtaacgagttaact
atgggacaaatggctgcagcaggatttatcagcgctattcctaccactttagtgactgcg
ccaacggaaagagtaaaggttgtcctgcaaacatcttctaagggctctttcattcaggcg
gctaaaaccattgttaaagaaggtggcatagcttctttatttaaaggttcattagccact
ttagcaagagatgggcctggctcagctctatattttgcatcttatgaaatttcaaaaaat
tacttgaatagtaggcaacctcgtcaagatgcgggcaaagatgaaccggtcaatatcttg
aacgtgtgtcttgctggtggtattgctggtatgtcgatgtggctagctgttttccccata
gacactataaagacaaaattgcaggcttcctccacgaggcagaatatgctttccgccaca
aaggaaatttatctacaaagaggtggtatcaagggatttttccctggtttaggtcctgct
ttactaagatctttcccagccaatgcggccacatttttaggtgtggagatgactcattca
ctgttcaagaagtatggcatatga

DBGET integrated database retrieval system