KEGG   Saccharomyces cerevisiae (budding yeast): YOR128CHelp
Entry
YOR128C           CDS       T00005                                 

Gene name
ADE2
Definition
(RefSeq) phosphoribosylaminoimidazole carboxylase ADE2
  KO
K11808  phosphoribosylaminoimidazole carboxylase [EC:4.1.1.21]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00230  Purine metabolism
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
Module
sce_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    YOR128C (ADE2)
Enzymes [BR:sce01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.21  phosphoribosylaminoimidazole carboxylase
     YOR128C (ADE2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRC ATP-grasp PurK_C 2-Hacid_dh_C AlaDh_PNT_C CPSase_L_D2 Dala_Dala_lig_C
Motif
Other DBs
NCBI-GeneID: 854295
NCBI-ProteinID: NP_014771
SGD: S000005654
UniProt: P21264
Position
XV:complement(564476..566191)
Genome map
AA seq 571 aa AA seqDB search
MDSRTVGILGGGQLGRMIVEAANRLNIKTVILDAENSPAKQISNSNDHVNGSFSNPLDIE
KLAEKCDVLTIEIEHVDVPTLKNLQVKHPKLKIYPSPETIRLIQDKYIQKEHLIKNGIAV
TQSVPVEQASETSLLNVGRDLGFPFVLKSRTLAYDGRGNFVVKNKEMIPEALEVLKDRPL
YAEKWAPFTKELAVMIVRSVNGLVFSYPIVETIHKDNICDLCYAPARVPDSVQLKAKLLA
ENAIKSFPGCGIFGVEMFYLETGELLINEIAPRPHNSGHYTIDACVTSQFEAHLRSILDL
PMPKNFTSFSTITTNAIMLNVLGDKHTKDKELETCERALATPGSSVYLYGKESRPNRKVG
HINIIASSMAECEQRLNYITGRTDIPIKISVAQKLDLEAMVKPLVGIIMGSDSDLPVMSA
ACAVLKDFGVPFEVTIVSAHRTPHRMSAYAISASKRGIKTIIAGAGGAAHLPGMVAAMTP
LPVIGVPVKGSCLDGVDSLHSIVQMPRGVPVATVAINNSTNAALLAVRLLGAYDSSYTTK
MEQFLLKQEEEVLVKAQKLETVGYEAYLENK
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atggattctagaacagttggtatattaggagggggacaattgggacgtatgattgttgag
gcagcaaacaggctcaacattaagacggtaatactagatgctgaaaattctcctgccaaa
caaataagcaactccaatgaccacgttaatggctccttttccaatcctcttgatatcgaa
aaactagctgaaaaatgtgatgtgctaacgattgagattgagcatgttgatgttcctaca
ctaaagaatcttcaagtaaaacatcccaaattaaaaatttacccttctccagaaacaatc
agattgatacaagacaaatatattcaaaaagagcatttaatcaaaaatggtatagcagtt
acccaaagtgttcctgtggaacaagccagtgagacgtccctattgaatgttggaagagat
ttgggttttccattcgtcttgaagtcgaggactttggcatacgatggaagaggtaacttc
gttgtaaagaataaggaaatgattccggaagctttggaagtactgaaggatcgtcctttg
tacgccgaaaaatgggcaccatttactaaagaattagcagtcatgattgtgagatctgtt
aacggtttagtgttttcttacccaattgtagagactatccacaaggacaatatttgtgac
ttatgttatgcgcctgctagagttccggactccgttcaacttaaggcgaagttgttggca
gaaaatgcaatcaaatcttttcccggttgtggtatatttggtgtggaaatgttctattta
gaaacaggggaattgcttattaacgaaattgccccaaggcctcacaactctggacattat
accattgatgcttgcgtcacttctcaatttgaagctcatttgagatcaatattggatttg
ccaatgccaaagaatttcacatctttctccaccattacaacgaacgccattatgctaaat
gttcttggagacaaacatacaaaagataaagagctagaaacttgcgaaagagcattggcg
actccaggttcctcagtgtacttatatggaaaagagtctagacctaacagaaaagtaggt
cacataaatattattgcctccagtatggcggaatgtgaacaaaggctgaactacattaca
ggtagaactgatattccaatcaaaatctctgtcgctcaaaagttggacttggaagcaatg
gtcaaaccattggttggaatcatcatgggatcagactctgacttgccggtaatgtctgcc
gcatgtgcggttttaaaagattttggcgttccatttgaagtgacaatagtctctgctcat
agaactccacataggatgtcagcatatgctatttccgcaagcaagcgtggaattaaaaca
attatcgctggagctggtggggctgctcacttgccaggtatggtggctgcaatgacacca
cttcctgtcatcggtgtgcccgtaaaaggttcttgtctagatggagtagattctttacat
tcaattgtgcaaatgcctagaggtgttccagtagctaccgtcgctattaataatagtacg
aacgctgcgctgttggctgtcagactgcttggcgcttatgattcaagttatacaacgaaa
atggaacagtttttattaaagcaagaagaagaagttcttgtcaaagcacaaaagttagaa
actgtcggttacgaagcttatctagaaaacaagtaa

DBGET integrated database retrieval system