KEGG   Saccharomyces cerevisiae (budding yeast): YOR130C
Entry
YOR130C           CDS       T00005                                 

Gene name
ORT1, ARG11
Definition
(RefSeq) Ort1p
  KO
K15114  mitochondrial ornithine carrier protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YOR130C (ORT1)
Transporters [BR:sce02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   YOR130C (ORT1)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 854297
NCBI-ProteinID: NP_014773
SGD: S000005656
UniProt: Q12375
Position
XV:complement(569929..570807)
AA seq 292 aa
MEDSKKKGLIEGAILDIINGSIAGACGKVIEFPFDTVKVRLQTQASNVFPTTWSCIKFTY
QNEGIARGFFQGIASPLVGACLENATLFVSYNQCSKFLEKHTNVSPLGQILISGGVAGSC
ASLVLTPVELVKCKLQVANLQVASAKTKHTKVLPTIKAIITERGLAGLWQGQSGTFIRES
FGGVAWFATYEIVKKSLKDRHSLDDPKRDESKIWELLISGGSAGLAFNASIFPADTVKSV
MQTEHISLTNAVKKIFGKFGLKGFYRGLGITLFRAVPANAAVFYIFETLSAL
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaggacagtaaaaagaaaggattaatagaaggcgctatactcgatataataaacggt
tccattgcaggcgcctgtggtaaggtgatcgagtttcctttcgatactgtgaaagtcagg
ttgcaaacacaagcatccaacgtgttcccaacaacatggtcttgtataaaatttacttac
caaaatgaaggaatagcacgagggttttttcaaggcattgcttcacctttagttggagca
tgtctggagaacgcgacattatttgtgtcttataaccaatgttctaaatttttagaaaaa
catacaaacgtttccccgttggggcaaatcctgatctctggtggagtagcgggttcatgt
gctagtttagttttgacacccgtggagctggtgaagtgtaagttgcaggttgcgaactta
caagttgcatcagctaaaacgaaacatacaaaggtgttgcctacaataaaagcaattata
actgagagaggattggcaggattgtggcaagggcaatcgggcacttttattcgagaaagc
ttcggtggtgttgcctggtttgcaacctacgaaatagttaagaagtcgttgaaagatagg
cactcccttgatgacccaaaaagagatgaaagtaagatatgggaactacttattagtgga
gggagcgctggattggcattcaacgccagtatttttcctgcggatactgtgaaatcagta
atgcaaactgaacatataagcctcaccaatgcggtgaagaagatatttggcaaatttgga
ctaaagggtttttatcgaggactgggtataaccctttttagggcagtaccagcaaacgct
gcagttttttacatctttgagactctttctgcactttaa

DBGET integrated database retrieval system