KEGG   Saccharomyces cerevisiae (budding yeast): YOR136WHelp
Entry
YOR136W           CDS       T00005                                 

Gene name
IDH2
Definition
(RefSeq) isocitrate dehydrogenase (NAD(+)) IDH2
  KO
K00030  isocitrate dehydrogenase (NAD+) [EC:1.1.1.41]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00020  Citrate cycle (TCA cycle)
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01130  Biosynthesis of antibiotics
sce01200  Carbon metabolism
sce01210  2-Oxocarboxylic acid metabolism
sce01230  Biosynthesis of amino acids
Module
sce_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sce_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YOR136W (IDH2)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.41  isocitrate dehydrogenase (NAD+)
     YOR136W (IDH2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 854303
NCBI-ProteinID: NP_014779
SGD: S000005662
UniProt: P28241
Structure
PDB: 

Position
XV:580250..581359
Genome map
AA seq 369 aa AA seqDB search
MLRNTFFRNTSRRFLATVKQPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFS
AANVPIEWESCDVSPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRK
TFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDAS
ERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSV
LKVVTNPSAYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAP
DIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSS
FTEAVIKRL
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgttgagaaatactttttttagaaacacctcgaggaggtttttggctactgtaaagcaa
ccttcaatcggaagatataccggcaaacctaacccttctaccggcaaatacacggtctcg
ttcattgaaggtgatggtatcggacctgaaatttccaagtctgtaaagaaaatctttagt
gcagcaaacgtccccatagaatgggaatcttgtgatgttagccctatctttgtcaacgga
ttaacgaccattcctgaccctgccgtacaatctatcacaaaaaacctggttgcactaaaa
ggtccactagctacacctattggtaaaggtcacagatctttgaatttgacattgagaaaa
acatttgggttatttgccaacgttcgtcccgcaaagtctattgaaggttttaagaccact
tacgaaaacgttgatttagttcttatcagagagaataccgaaggtgaatattctggtatc
gaacacatagtttgccctggcgttgttcaatctattaaactgatcacaagagatgcctct
gagcgagtcattagatacgcttttgaatatgcaagagccatcggcagaccaagagttatt
gtggtacataaatctactatccagagattagctgatggtttattcgttaatgttgccaaa
gaactatccaaagagtatcctgaccttactttagaaactgaacttattgataacagtgtg
ttaaaggtggtcaccaacccatctgcttacacagacgctgtttctgtttgtccaaatcta
tacggtgatatcttgtccgacttgaactctggtttgagcgccggttctttaggtttaact
ccatctgccaatattggtcataaaatctcgatctttgaagctgtccatggctctgcccct
gatattgccggtcaagataaagcgaatccaactgccctacttttatcttcagtaatgatg
ttaaaccacatgggtctaacgaatcatgctgaccaaattcaaaatgcagtattgtctact
atcgcatcaggtccagaaaacagaacaggtgacttggctggtactgctactacttcatca
ttcactgaagcagtcatcaagagattataa

DBGET integrated database retrieval system