KEGG   Saccharomyces cerevisiae (budding yeast): YOR150WHelp
Entry
YOR150W           CDS       T00005                                 

Gene name
MRPL23
Definition
(RefSeq) mitochondrial 54S ribosomal protein YmL23
  KO
K02871  large subunit ribosomal protein L13
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03010  Ribosome
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    YOR150W (MRPL23)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sce03011]
    YOR150W (MRPL23)
Ribosome [BR:sce03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    YOR150W (MRPL23)
  Bacteria
    YOR150W (MRPL23)
  Archaea
    YOR150W (MRPL23)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L13
Motif
Other DBs
NCBI-GeneID: 854321
NCBI-ProteinID: NP_014793
SGD: S000005676
UniProt: Q12487
Position
XV:611999..612490
Genome map
AA seq 163 aa AA seqDB search
MSQKIGHSGLAFARLWHHVDVARDKRTLGRLASAIAITLIGRHKPVYHPSQDCGDYVVVT
NCQKIRVTGKKFEQKTYWSHSGRPGQLKLQTMNKVVADKGFGEILKKAVSGMLPKNKLRK
QRLDRLKVFDGSENPYKQNITAFAHEQSSIPEPLKESIFNQLK
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagaagattggacacagtggcttggcttttgcgcgcctttggcaccatgtcgac
gttgcccgtgataagaggacattgggtagattggcttcagcaattgcaattaccttaatt
ggtagacataagccggtctatcatccgtcacaagactgtggagactacgtagtagtgact
aattgccaaaaaatccgtgtaacaggtaagaaatttgagcagaagacttactggtctcat
tcaggtagacctggtcagctaaagttacagacaatgaacaaggttgttgccgataaagga
tttggagaaattttgaaaaaagcagttagcggtatgttgcctaaaaataaattgagaaag
caacggttagaccgcttaaaagttttcgatggaagtgaaaacccttataaacaaaatatt
actgcctttgcccatgagcaatcatcaataccagagcctcttaaagaatcaatttttaac
caattgaaatag

DBGET integrated database retrieval system