KEGG   Saccharomyces cerevisiae (budding yeast): YOR151CHelp
Entry
YOR151C           CDS       T00005                                 

Gene name
RPB2, RPB150, RPO22, SIT2, SOH2
Definition
(RefSeq) DNA-directed RNA polymerase II core subunit RPB2
  KO
K03010  DNA-directed RNA polymerase II subunit RPB2 [EC:2.7.7.6]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03020  RNA polymerase
Module
sce_M00180  RNA polymerase II, eukaryotes
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    YOR151C (RPB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sce03021]
    YOR151C (RPB2)
   03400 DNA repair and recombination proteins [BR:sce03400]
    YOR151C (RPB2)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     YOR151C (RPB2)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Core subunits
     YOR151C (RPB2)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      YOR151C (RPB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_pol_Rpb2_6 RNA_pol_Rpb2_1 RNA_pol_Rpb2_2 RNA_pol_Rpb2_7 RNA_pol_Rpb2_4 RNA_pol_Rpb2_3 RNA_pol_Rpb2_5
Motif
Other DBs
NCBI-GeneID: 854322
NCBI-ProteinID: NP_014794
SGD: S000005677
UniProt: P08518
Structure
PDB: 

Position
XV:complement(612997..616671)
Genome map
AA seq 1224 aa AA seqDB search
MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQ
DIICEDSTLILEQLAQHTTESDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLR
NLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDSESGKVFIGRLPIMLRSKNCY
LSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEH
ICYDVNDWQMLEMLKPCVEDGFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEF
LPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDHFGKKRLDLAGPLLAQLFKTL
FKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLS
LMSCISVGTDPMPIITFLSEWGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETL
RTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIVEDDESLGHKELKVRKGHIAK
LMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGV
FLTNYNVRMDTMANILYYPQKPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMI
MNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRTNTLRMKHGTYDKLDDDGLIA
PGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSR
MTVAHLIECLLSKVAALSGNEGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKK
LMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVEGRSRDGGLRFGEMERDCMIA
HGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF
NT seq 3675 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaccttgcaaactcagaaaagtattatgatgaggacccatatggattcgaggat
gaaagtgcaccaattactgcagaagattcgtgggctgttatatccgctttttttcgcgag
aaggggctagtttcacaacaacttgactctttcaatcaattcgttgattatactttacaa
gacattatttgcgaggattccaccttgattttagagcagttggctcaacatactaccgaa
tcagacaacatcagtagaaagtatgagattagttttggtaaaatctatgttacaaagcca
atggtaaatgaatctgatggtgttacccatgcgttgtatccacaagaagcacgtttacgt
aatttgacatattcgtctggtttatttgttgatgttaagaagagaacatatgaagctatt
gatgttccaggtagggaactgaaatatgaattaattgccgaagaatctgaagatgacagc
gaaagcggaaaagttttcattggccgtttaccgattatgttaagatcaaagaattgttac
ctaagtgaggctacagaatcagatttatataagctgaaagaatgtccctttgatatgggt
ggttatttcatcattaatggttctgaaaaagttttgattgcacaggagcgttctgcaggt
aatattgttcaagtgtttaaaaaagccgccccatctccaatttctcatgtagcagaaatt
agatctgcccttgaaaaaggttctaggtttatcagtacccttcaagtcaagctttatggt
cgtgagggtagttcagctcgtactattaaagccacattaccatatatcaaacaggatatt
cctattgtaatcatattcagagctttaggtattattccagacggtgaaattttagaacat
atctgctacgacgtaaatgattggcaaatgctggaaatgcttaagccttgtgttgaagac
gggtttgttattcaagatcgtgaaactgcattagactttattggtcgtcgtggtactgcc
cttggtattaagaaagaaaaaagaatccaatatgcaaaagacattttacaaaaagaattc
ctacctcatattactcaattagaaggttttgaaagtagaaaggcatttttcttaggttat
atgataaacagattattactgtgtgctttagatcgtaaagaccaagatgatcgtgatcat
ttcgggaaaaaaagattagatttggcaggtccattattggcccaacttttcaagacattg
ttcaaaaaattaactaaagatattttccgttatatgcaaagaactgtagaggaagcccat
gactttaacatgaaattagcgattaacgcaaaaaccataacatcgggtcttaagtacgct
ttggctactggtaactggggtgaacaaaaaaaagccatgtcttctagggcaggtgtttct
caggttttgaaccgttacacttattcatccaccttatcacatttaagaagaacaaatacc
cctattggtcgtgatggtaaattagccaaaccacgtcaattgcataatacacattggggg
ttggtctgtcctgcagaaactcctgaaggccaagcgtgtggtttagttaagaatctgtca
ctgatgtcttgtatttctgttggtacagatccgatgcctatcatcacttttttgagtgaa
tggggtatggaaccactggaagattacgtaccacatcaatcacctgacgcgacaagggtc
ttcgtcaatggtgtttggcacggtgttcacagaaacccagcaagattaatggaaaccctt
agaacattgagaagaaagggtgatatcaatccggaagtttctatgattagagatattcgt
gaaaaggagctaaaaatctttacagatgccggtagagtttatagaccattatttattgtt
gaagacgatgaatcactaggccataaggaattaaaggtaagaaagggtcatattgccaaa
ctgatggctaccgaatatcaagatattgaaggtggatttgaagatgtagaagaatataca
tggtcatcattattgaatgagggtttagtggaatacattgatgctgaagaagaagaatct
atattgatcgcaatgcaaccggaagatctcgagcctgcagaggcaaatgaggaaaacgat
ctcgatgttgatcctgccaaacgtataagagtatcacatcatgctacaacatttacacat
tgtgagattcatccttctatgattctcggtgtcgcagcatccattattccattccctgac
cataatcaatctccgcgtaacacttaccaatctgcgatgggtaagcaagctatgggtgtg
tttttaacaaactataatgtgcgtatggatactatggccaatattctatattatcctcaa
aaaccattgggtactacacgtgcgatggaatatttgaagtttagagaattacccgctggt
caaaatgcaattgttgctattgcatgttactccggttataatcaagaagattctatgatt
atgaaccagtcttcaattgatcgtggtctattcagatctctgtttttcagatcttatatg
gatcaggaaaagaagtacggtatgtctataacggagacttttgagaaaccacaacgtaca
aacaccttaagaatgaaacatggtacatacgataagttggacgatgatggtctaattgcg
cctggtgttagagtttcaggagaagatgtgattatcggtaaaaccacaccaatctcacca
gatgaagaggaactcggtcaaagaacagcataccattccaaacgtgatgcttccacacca
ttgagaagtactgaaaacggtattgttgatcaagttttagtcacaacaaaccaagatggg
ttaaagtttgtcaaagttcgtgtaagaactacaaagattcctcaaattggtgacaaattt
gcttctcgtcacggtcaaaagggtactattggtatcacatatcgtagagaagatatgcca
tttaccgcagaaggtattgttccagatttgattattaaccctcatgctattccatctcgt
atgactgttgcccatttaattgaatgtttgttgagtaaagtcgcggcactatctggtaat
gaaggtgacgcctctcctttcacggacattactgtagaaggtatatccaaactactgcgt
gagcatggttatcaatctcgtgggtttgaagttatgtataatggtcacacaggtaaaaaa
ctaatggctcaaattttctttggtcctacatattatcaacgactaagacacatggtggat
gacaagatacatgccagagcacgtggtccaatgcaagtattgacgagacagcctgtagag
ggtagatcgagagacggtggtttaagattcggtgagatggaacgtgactgtatgattgct
catggtgctgcctcattcttgaaggagagattaatggaagcatccgatgcctttagagtc
catatttgtggtatttgcgggctgatgacagttatcgcgaaattaaatcataaccaattt
gaatgtaagggatgtgataataagattgatatttaccaaattcatattccatacgccgcg
aagttattattccaagaacttatggctatgaacattacaccacgtttatataccgatcgt
tcgagagatttttaa

DBGET integrated database retrieval system