KEGG   Saccharomyces cerevisiae (budding yeast): YOR153WHelp
Entry
YOR153W           CDS       T00005                                 

Gene name
PDR5, LEM1, STS1, YDR1
Definition
(RefSeq) ATP-binding cassette multidrug transporter PDR5
  KO
K08711  ATP-binding cassette, subfamily G (WHITE), member 2, PDR
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sce00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    YOR153W (PDR5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YOR153W (PDR5)
Transporters [BR:sce02000]
 ABC Transporters, Eukaryotic Type
  ABCG (White) subfamily
   ABCG2, 3 subgroups
    YOR153W (PDR5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC2_membrane ABC_tran PDR_CDR ABC_trans_N AAA_16 AAA_25 AAA_18 RsgA_GTPase AAA_21 AAA_29 SMC_N AAA_33 AAA_23 cobW OCD_Mu_crystall AAA_22 DnaB_C AAA_28 MSC
Motif
Other DBs
NCBI-GeneID: 854324
NCBI-ProteinID: NP_014796
SGD: S000005679
UniProt: P33302
Position
XV:619840..624375
Genome map
AA seq 1511 aa AA seqDB search
MPEAKLNNNVNDVTSYSSASSSTENAADLHNYNGFDEHTEARIQKLARTLTAQSMQNSTQ
SAPNKSDAQSIFSSGVEGVNPIFSDPEAPGYDPKLDPNSENFSSAAWVKNMAHLSAADPD
FYKPYSLGCAWKNLSASGASADVAYQSTVVNIPYKILKSGLRKFQRSKETNTFQILKPMD
GCLNPGELLVVLGRPGSGCTTLLKSISSNTHGFDLGADTKISYSGYSGDDIKKHFRGEVV
YNAEADVHLPHLTVFETLVTVARLKTPQNRIKGVDRESYANHLAEVAMATYGLSHTRNTK
VGNDIVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIRALKTQADISNT
SATVAIYQCSQDAYDLFNKVCVLDDGYQIYYGPADKAKKYFEDMGYVCPSRQTTADFLTS
VTSPSERTLNKDMLKKGIHIPQTPKEMNDYWVKSPNYKELMKEVDQRLLNDDEASREAIK
EAHIAKQSKRARPSSPYTVSYMMQVKYLLIRNMWRLRNNIGFTLFMILGNCSMALILGSM
FFKIMKKGDTSTFYFRGSAMFFAILFNAFSSLLEIFSLYEARPITEKHRTYSLYHPSADA
FASVLSEIPSKLIIAVCFNIIFYFLVDFRRNGGVFFFYLLINIVAVFSMSHLFRCVGSLT
KTLSEAMVPASMLLLALSMYTGFAIPKKKILRWSKWIWYINPLAYLFESLLINEFHGIKF
PCAEYVPRGPAYANISSTESVCTVVGAVPGQDYVLGDDFIRGTYQYYHKDKWRGFGIGMA
YVVFFFFVYLFLCEYNEGAKQKGEILVFPRSIVKRMKKRGVLTEKNANDPENVGERSDLS
SDRKMLQESSEEESDTYGEIGLSKSEAIFHWRNLCYEVQIKAETRRILNNVDGWVKPGTL
TALMGASGAGKTTLLDCLAERVTMGVITGDILVNGIPRDKSFPRSIGYCQQQDLHLKTAT
VRESLRFSAYLRQPAEVSIEEKNRYVEEVIKILEMEKYADAVVGVAGEGLNVEQRKRLTI
GVELTAKPKLLVFLDEPTSGLDSQTAWSICQLMKKLANHGQAILCTIHQPSAILMQEFDR
LLFMQRGGKTVYFGDLGEGCKTMIDYFESHGAHKCPADANPAEWMLEVVGAAPGSHANQD
YYEVWRNSEEYRAVQSELDWMERELPKKGSITAAEDKHEFSQSIIYQTKLVSIRLFQQYW
RSPDYLWSKFILTIFNQLFIGFTFFKAGTSLQGLQNQMLAVFMFTVIFNPILQQYLPSFV
QQRDLYEARERPSRTFSWISFIFAQIFVEVPWNILAGTIAYFIYYYPIGFYSNASAAGQL
HERGALFWLFSCAFYVYVGSMGLLVISFNQVAESAANLASLLFTMSLSFCGVMTTPSAMP
RFWIFMYRVSPLTYFIQALLAVGVANVDVKCADYELLEFTPPSGMTCGQYMEPYLQLAKT
GYLTDENATDTCSFCQISTTNDYLANVNSFYSERWRNYGIFICYIAFNYIAGVFFYWLAR
VPKKNGKLSKK
NT seq 4536 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaggccaagcttaacaataacgtcaacgacgttactagctactcctccgcgtct
tcttctactgaaaacgctgctgatctacacaattataatgggttcgatgagcatacagaa
gctcgaatccaaaaactggcaaggactctgaccgcacagagtatgcaaaactccactcaa
tcggcacccaacaaaagtgatgctcagtctatattttctagcggtgtggaaggtgtaaac
ccgatattctctgatcctgaagctccaggctatgacccaaaattggaccccaactccgaa
aatttttctagtgccgcctgggttaagaatatggctcacctaagtgcggcagaccctgac
ttttataagccttattccttaggttgcgcttggaagaacttaagtgcttctggtgcttcc
gcagatgtcgcctatcagtcaactgtggttaatattccatacaaaatcctaaaaagtggg
ctgagaaagtttcaacgttctaaagaaaccaatactttccaaatcttgaaaccaatggat
ggttgcctaaacccaggtgaattgctagtcgttttaggtagaccaggctctggctgtact
actttattaaaatccatctcttcaaatactcatggttttgatcttggtgcagatactaaa
atttcttacagcggctactcaggtgatgatattaagaaacattttcgtggtgaagttgtt
tacaacgcagaagctgatgtacatctgcctcatttaacagtcttcgaaactttggttaca
gtagcgaggttgaaaaccccacagaaccgtatcaagggtgtcgatagggaaagttatgcg
aatcatttggcggaagtagcaatggcaacgtacggtttatcgcatacaaggaatacaaaa
gttggtaacgacatcgtcagaggtgtttccggtggtgaaaggaagcgtgtctccattgct
gaagtctccatctgtggatccaaatttcaatgctgggataatgctacaaggggtttggat
tccgctaccgctttggaatttattcgtgccttaaagactcaagctgatatttccaataca
tctgccacagtggccatctatcaatgttctcaagatgcgtacgacttgttcaataaagtc
tgtgttttggatgatggttatcagatctactatggccccgccgataaggccaagaagtac
tttgaagatatggggtatgtttgtccaagcagacaaaccaccgcagattttttgacctca
gttacaagtccctctgagagaaccctgaacaaagatatgctaaaaaaaggtattcatata
ccacagaccccgaaggaaatgaacgattactgggtaaaatctccaaattacaaagagcta
atgaaagaagtcgaccaacgattattgaatgacgatgaagcaagccgtgaagctattaag
gaagcccacattgctaagcagtccaagagagcaagaccttcctctccttatactgtcagc
tacatgatgcaagttaaatacctattaatcagaaatatgtggagactgcgaaataatatc
gggtttacattatttatgattttgggtaactgtagtatggctttaatcttgggttcaatg
tttttcaagatcatgaaaaagggtgatacttctacattctatttccgtggttctgctatg
ttttttgcaattctattcaatgcattttcttctctgttagaaatcttttcgttatatgag
gccagaccaatcactgaaaaacatagaacatattcgttataccatccaagtgctgacgct
tttgcatcagttctatcagaaataccctcaaagttaatcatcgctgtttgcttcaatata
atcttctatttcttagtagactttagaagaaatggtggtgtattctttttctacttatta
ataaacattgtcgcggttttctccatgtctcacttgtttagatgtgttggttccttaaca
aagacattgtcagaagctatggttcccgcttctatgttattgttggctctatccatgtat
accggttttgctattcctaagaagaagatcctacgttggtctaaatggatttggtatatc
aatccgttggcttacttattcgaatctttgttaattaacgagtttcatggtataaaattc
ccctgcgctgaatatgttcctcgtggtcctgcgtatgcaaacatttctagtacagaatct
gtttgtaccgtggttggagctgttccaggccaagactatgttctgggtgatgatttcatt
agaggaacttatcaatactaccacaaagacaaatggcgtggtttcggtattggtatggct
tatgtcgtcttctttttctttgtctatctattcttatgtgaatacaacgagggtgctaaa
caaaaaggtgaaatattagttttcccacgcagtatagttaaaagaatgaagaaaagaggt
gtactaactgaaaagaatgcaaatgaccccgaaaacgttggggaacgtagtgacttatcc
agcgataggaaaatgctacaagaaagctctgaagaggaatccgatacttacggagaaatt
ggtttatccaagtcagaggctatatttcactggagaaacctttgttacgaagttcagatt
aaggccgaaacaagacgtattttgaacaatgttgatggttgggttaaaccaggtacttta
acagctttaatgggtgcttcaggtgctggtaaaaccacacttctggattgtttggccgaa
agggttaccatgggtgttataactggtgatatcttggtcaatggtattccccgtgataaa
tctttcccaagatccattggttattgtcagcaacaagatttgcatttgaaaactgccact
gtgagggagtcattgagattttctgcttacctacgtcaaccagctgaagtttccattgaa
gaaaagaacagatatgttgaagaagttattaaaattcttgaaatggaaaaatatgctgat
gctgttgttggtgttgctggtgaaggtttaaacgttgaacaaagaaaaagattaaccatt
ggtgttgaattaactgccaaaccaaaactgttggtctttttagatgaacctacttctggt
ttggattctcaaactgcttggtctatttgtcagctaatgaaaaagttggcaaatcatggt
caagcaattctatgtactattcaccaaccctctgctattttgatgcaagaattcgatcgt
ttactatttatgcaacgtggtggtaagactgtctactttggcgacttgggcgaaggttgt
aaaactatgatcgattattttgaaagccatggtgctcataaatgccctgctgacgccaac
ccagctgaatggatgctagaagttgttggtgcagctccaggctctcatgcaaatcaagat
tattacgaagtttggaggaattctgaagagtacagggccgttcaatctgaattagattgg
atggaaagagaattaccaaagaaaggttcgataactgcagctgaggacaaacacgaattt
tcacaatcaattatttatcaaacaaaattggtcagtattcgtctattccagcaatattgg
agatctccagattatttatggtcgaagtttattttaactattttcaatcaattgttcatc
ggtttcactttcttcaaagcaggaacctcgctacagggtttacaaaatcaaatgttggct
gtgttcatgtttacggttattttcaatcctattctacaacaatacctaccatcttttgtc
cagcaaagagatttgtatgaggccagggaacgcccctcaaggactttttcttggatttca
tttatcttcgctcaaatattcgtggaagttccatggaatatattggcaggtactattgct
tattttatctactattatccaattggattttactccaacgcgtctgcagctggccagttg
catgaaaggggtgctttattttggttgttctcttgtgctttctacgtttatgttggttct
atgggtctgcttgtcatttcattcaaccaagttgcagaaagtgcagctaacttagcctct
ttgttgtttacaatgtctttgtctttttgtggtgttatgactaccccaagtgccatgcct
agattttggatattcatgtacagggtttcacctttgacttatttcattcaggctctgttg
gctgttggtgttgctaacgtagacgtcaaatgcgctgattacgaattgctagaattcaca
ccaccatccggtatgacatgtgggcagtacatggaaccatatttacaactagcaaagact
ggttacttaactgatgaaaatgccactgacacctgtagtttctgtcaaatatctacaacc
aatgattacttagctaatgtcaattctttctacagtgagagatggagaaattatggtatc
ttcatctgttatattgcattcaattatatcgctggtgtctttttctactggttagcaaga
gtgcctaaaaagaacggtaaactctccaagaaataa

DBGET integrated database retrieval system