KEGG   Saccharomyces cerevisiae (budding yeast): YOR155CHelp
Entry
YOR155C           CDS       T00005                                 

Gene name
ISN1
Definition
(RefSeq) IMP 5'-nucleotidase
  KO
K18550  IMP and pyridine-specific 5'-nucleotidase [EC:3.1.3.99 3.1.3.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00230  Purine metabolism
sce00760  Nicotinate and nicotinamide metabolism
sce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    YOR155C (ISN1)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    YOR155C (ISN1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.99  IMP-specific 5'-nucleotidase
     YOR155C (ISN1)
    3.1.3.-  
     YOR155C (ISN1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ISN1
Motif
Other DBs
NCBI-GeneID: 854326
NCBI-ProteinID: NP_014798
SGD: S000005681
UniProt: Q99312
Position
XV:complement(626628..627980)
Genome map
AA seq 450 aa AA seqDB search
MSSRYRVEYHLKSHRKDEFIDWVKGLLASPFVLHAVSHEGDYNDDLATTQRVRSQYADIF
KDIEGLIKDKIEFDSRNMSQDEIEDGASSQSLNILGQSRLNLLVPSIGTFFTELPLEQAF
LWEDSQRAISARRMVAPSFNDIRHILNTAQIFHFKKQENLHNGKVLRLVTFDGDVTLYED
GGSLVYTNPVIPYILKLLRCGINVGIVTAAGYDEAGTYENRLKGLIVALHDSTDIPVSQK
QNLTIMGGESSYLFRYYEDPEEDNFGFRQIDKEEWLLPRMKAWSLEDVEKTLDFAERTLN
RLRKRLNLPSEISIIRKVRAVGIVPGERYDEASKRQVPVKLDREQLEEIVLTLQNTLESF
APSRRIQFSCFDGGSDVWCDIGGKDLGVRSLQQFYNPESPIQPSETLHVGDQFAPVGSAN
DFKARLAGCTLWIASPQETVNYLHRLLETD
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcaagatatagagtggaatatcatttgaagagccaccgcaaggatgagtttata
gattgggtaaaggggctactggcctcaccttttgttctacatgccgtctctcatgaaggt
gactacaatgacgacttagcaacaactcaacgtgtaaggtcgcagtatgctgatatcttt
aaagacattgaagggctgattaaagataaaatagaatttgactcaagaaacatgagccaa
gacgaaattgaagatggcgcctcttctcaatctctgaatatattaggacaatcgcgttta
aatcttttggttccatcaattggaacattctttacggaacttccattggaacaagctttt
ctatgggaagactcacaacgggccatttcggcgcgtagaatggtagcacccagttttaat
gatatcaggcatatcctgaatactgcacagatatttcactttaagaaacaggagaactta
cataatggtaaggttttgagattagtgacttttgatggagatgtgacgctgtatgaagat
ggtggctccctggtttacactaatcctgtaattccttatattctcaagctgttgcggtgc
ggtatcaatgtgggaatagtcactgcggccggatatgatgaagctggaacctatgagaac
agattgaaaggattaattgttgcattacatgattcaactgatataccagtttctcaaaag
cagaatttaacaataatgggtggtgagtcgagttaccttttccgttactatgaagacccg
gaggaagataactttggctttagacaaattgacaaagaggaatggctattgcctagaatg
aaggcttggtccctcgaggacgtggaaaagactttggactttgccgagagaactcttaac
aggttaagaaaaagactaaacctaccttcagagatttctattatccgtaaagtcagggca
gtgggtatcgtcccaggcgaacggtacgatgaagcttctaaaagacaagttcctgttaag
cttgatagggaacaactggaggaaatagttttaacccttcaaaacactttagagtctttt
gccccatctagaagaattcaatttagttgttttgatggtggtagtgatgtctggtgtgat
attggggggaaagatcttggtgttcgttcattgcaacaattttataaccctgaatctcct
atccaaccctctgaaaccttacacgtaggcgatcagtttgcaccggtgggatcagcaaat
gattttaaggcaaggctagctggatgtaccctctggatagcatcccctcaagaaacagtg
aattatcttcatagattattagaaactgattaa

DBGET integrated database retrieval system