KEGG   Saccharomyces cerevisiae (budding yeast): YOR157CHelp
Entry
YOR157C           CDS       T00005                                 

Gene name
PUP1
Definition
(RefSeq) proteasome core particle subunit beta 2
  KO
K02739  20S proteasome subunit beta 2 [EC:3.4.25.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03050  Proteasome
Module
sce_M00340  Proteasome, 20S core particle
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    YOR157C (PUP1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sce01002]
    YOR157C (PUP1)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:sce03051]
    YOR157C (PUP1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     YOR157C (PUP1)
Peptidases [BR:sce01002]
 Threonine Peptidases
  Family T1: proteasome family
   YOR157C (PUP1)
Proteasome [BR:sce03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    YOR157C (PUP1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Proteasome Pr_beta_C
Motif
Other DBs
NCBI-GeneID: 854328
NCBI-ProteinID: NP_014800
SGD: S000005683
UniProt: P25043
Structure
PDB: 
1RYP 4R17 1G65 6HWE 5CZ4 4QVP 5L5A 4Y7Y 4Y8L 4Y70 4R18 4QLQ 3NZJ 1G0U 3GPT 4G4S 6HWF 6H39 5LAI 5L5F 5D0S 5CZ7 5CZA 5CGH 4YA5 4Y7W 4Y80 4Y8H 4Y77 4RUR 4R02 4QV1 4NO1 4NNN 4LTC 3NZW 3HYE 3GPW 4QVY 4EU2 3MG8 6HW3 6HWB 5L5H 5L5O 5L5S 5L5U 5L67 5L6B 5L6C 5FG9 5FGE 5FGF 5D0T 5D0X 5BOU 4Y7X 4Y8G 4Y8I 4Y8K 4Y8N 4Y8Q 4Y6A 4QZX 4QWG 4QWI 4QWL 4QVQ 4QV7 4QV9 4Q1S 4NNW 3OEU 3MG6 3D29 3SDI 3MG0 6HVY 6HW6 6HW7 6G8M 6G7F 5M2B 5LTT 5L5V 5L5Y 5L5Z 5L60 5L63 5L64 5L69 5L52 5FHS 5FG7 5FGA 5FGG 5CZ6 4YA2 4YA3 4YA7 4YA9 4Y84 4Y8J 4Y8O 4Y8R 4Y8S 4Y8T 4Y6Z 4Y74 4X6Z 4QZ2 4QW7 4QV4 4QV5 4NO8 4LQI 4INR 3UN8 3TDD 3SDK 3OKJ 3NZX 3GPJ 3BDM 3MG7 6HVX 6HW0 6HW8 6HW9 6HWA 6HWC 6HWD 5L5B 5L5D 5L5P 5L5Q 5L5W 5L61 5L62 5L66 5L68 5L6A 5L54 5FGD 5FGH 5DKI 5DKJ 5D0W 5CZ5 5CZ8 5CGF 5CGI 5BXL 5BXN 4Y9Y 4Y9Z 4YA0 4Y81 4Y82 4Y8M 4Y8P 4Y6V 4Y75 4Y78 5AHJ 4R00 4QZ3 4QZ5 4QZ7 4QXJ 4QVV 4QW4 4QWK 4QVL 4QVM 4QUY 4QV6 4QLS 4QLT 4QLU 4JSQ 4J70 4HRC 4HRD 4HNP 4GK7 4FZC 3SHJ 3DY4 2FAK 2F16 3DY3 2GPL 3OEV 6HW4 6HW5 6GOP 5LAJ 5L5E 5L5I 5L5J 5L5R 5L5T 5L5X 5L65 5L55 5JHR 5FGI 5D0V 5D0Z 5CZ9 5CGG 4YA1 4YA4 4Y8U 4Y69 4QZZ 4QZ6 4QWR 4QWX 4QW0 4QW1 4QW3 4QW6 4QWJ 4QVN 4QV8 4QLV 4NO9 4JSU 4INT 2ZCY 6G8N 5NIF 5JHS 4Z1L 4QZW 4QZ0 4QZ1 4QZ4 4QWS 4QWU 4QVW 4QW5 4QWF 4QUX 4QV3 4QBY 4NO6 4FZG 3E47 1JD2 4QV0 4JT0 4INU 3MG4 3WXR 1FNT 1Z7Q 3UN4 5MP9 6EF3 5MPA 4CR2 4CR4 4CR3 5A5B
Thumbnails

Position
XV:complement(630966..631751)
Genome map
AA seq 261 aa AA seqDB search
MAGLSFDNYQRNNFLAENSHTQPKATSTGTTIVGVKFNNGVVIAADTRSTQGPIVADKNC
AKLHRISPKIWCAGAGTAADTEAVTQLIGSNIELHSLYTSREPRVVSALQMLKQHLFKYQ
GHIGAYLIVAGVDPTGSHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKEEA
IKLASDAIQAGIWNDLGSGSNVDVCVMEIGKDAEYLRNYLTPNVREEKQKSYKFPRGTTA
VLKESIVNICDIQEEQVDITA
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcaggtttatcgttcgacaattatcaaagaaataatttcttagcggaaaactcgcac
acacaacctaaggcaacttccacgggtaccaccattgtaggcgtaaaattcaataacgga
gtggtgattgcagcagatacaagatcaacacaaggtccaattgtcgcagataagaattgc
gcaaaattgcatagaatttcccccaaaatatggtgtgctggtgccggtaccgccgccgat
actgaggcagttacgcagttgatcgggtctaacattgaattacattccttatatacctcg
agagaaccaagagtggtctcagctttacaaatgctaaagcagcacctatttaagtaccaa
ggtcatattggtgcttatttgattgttgcaggtgtagaccctacgggatctcatttgttc
tccattcatgcgcatggttctactgacgtgggctactacctttctctaggatctggttct
ctagcggcaatggctgtgttggaatcacactggaagcaagaccttacgaaggaggaagcc
ataaagttggcctctgatgcaatccaggctggtatctggaatgatttggggtctggttct
aatgtggatgtgtgtgtcatggaaataggtaaagatgcagaatacttgaggaattacttg
actccaaatgttagagaagaaaagcagaaaagctacaaattccccaggggtacaactgct
gtgctgaaggagagtattgtcaatatttgtgacatacaagaagaacaagtcgatataacg
gcttga

DBGET integrated database retrieval system