KEGG   Saccharomyces cerevisiae (budding yeast): YOR160WHelp
Entry
YOR160W           CDS       T00005                                 

Gene name
MTR10, KAP111
Definition
(RefSeq) Mtr10p
  KO
K15436  transportin-3
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sce03016]
    YOR160W (MTR10)
Transfer RNA biogenesis [BR:sce03016]
 Eukaryotic Type
  tRNA transport factors
   tRNA import factors
    YOR160W (MTR10)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Xpo1 IBN_N
Motif
Other DBs
NCBI-GeneID: 854331
NCBI-ProteinID: NP_014803
SGD: S000005686
UniProt: Q99189
Position
XV:633839..636757
Genome map
AA seq 972 aa AA seqDB search
MDNLQVSDIETALQCISSTASQDDKNKALQFLEQFQRSTVAWSICNEILSKEDPTNALLE
LNIFAAQTLRNKVTYDLSQLENNLPQFKDSLLTLLLSHNQKLIITQLNVALARLAIQFLE
WQNPIFEIISLLNSSPSILLNFLRILPEETLDIASTSLTEVEFNSRIHELIDPIAEDVLK
FLVSCIDLLQNTDGNSSSSISLEQILRCLNSWSYEFPVEQLLTVQPLINLVFETISNGNE
SDMEAFDSAIDCLCVILRESRDTTNEQLISALFHQLMLLQEKLLPTLFTDHPLNDEYDDD
LLEGMTRLFVEAGEAWSVVISKNPDFFKPMVLVLLMLTCKNEDLDVVSYTFPFWFNFKQS
LVLPRYQESRKAYSDIFVKLINGIITHLQYPSGQFSSKEEEDKFKDFRYHMGDVLKDCTA
VVGTSEALSQPLIRIKSAIENNNSWQIMEAPLFSLRTMAKEISLTENTILPEIIKIICNL
PEQAKIRYASTLVLGRYTEWTAKHPELLEVQLQYIFNGFQLHEGSSDMQSIITASSHALM
FFCSDCSKLLVGYIDQLINFFLNVQSSIDIESQFELCQGLSAVINNQPEAKVSVIFQKLV
DDNLRQIEALIPQWKANPTLLAPQIADKIDLLYALFEELKPRYNYPQQGSEPLLPRIEFI
WKALRTLLVDAGAMTDSIIVERVAKLLRRIFERFHVFCEPILPSVAEFLIQGYLTTGFGS
YLWCSGSLIVIFGDDESFPISPSLKDAVWKFALSQCETFILNFNKFDKLQLNDYHEAIID
FFSLISDLIMFYPGAFLNSTELLGPVLNVALECVNKLDNYDAYICILRCLDDIISWGFKT
PPISTVSIEIVPDEWRKQVINEVVIAHGNQLILVLFIGLVTTFENTAHSDAISCIVKCLR
ILTEANNNDATICIDWIYKVVEQLGQVTLNERDNLAKAVVEGLNSKDYRKVREGIRAFVG
WYSRKNINSRFE
NT seq 2919 nt NT seq  +upstreamnt  +downstreamnt
atggacaacttacaggtatctgatatagaaactgctttacaatgcatatcgtctactgca
tctcaagatgataaaaacaaagcgcttcaatttttagaacaattccaaagatcaactgtt
gcctggtctatttgcaatgaaatattgtctaaagaagatcctacaaacgctcttctagaa
ttaaatatttttgctgcgcaaactttaaggaataaagtcacatatgatctatcacaatta
gaaaataatctaccacaattcaaggattctttgttgacgcttttattatcgcataaccaa
aaattgattattacacaactgaatgtcgcgttagcacgtttggcgatccaatttttagaa
tggcagaatccaattttcgagatcatttcattgttgaattcttcaccatctatattatta
aactttttaagaattttacctgaggaaaccttagacattgcatctacttccttgacagaa
gtggaattcaattccagaattcatgaactaattgatccgatagcagaagatgtattgaaa
ttccttgtatcatgcatagacctattacaaaatacagacgggaattccagctcatctatt
tcattagaacaaattttacggtgtttgaactcttggtcgtatgaattccctgttgaacag
ttgctaaccgtacaacccttaataaatctcgtgtttgaaactatttccaatggtaatgaa
agtgacatggaggcattcgattccgctattgattgtctctgcgttatcctcagagaaagc
agagatactactaatgagcagttgatttctgctttatttcatcagttaatgcttttacaa
gaaaaactattgcctactctgttcacagaccatcctttgaacgatgaatatgatgacgat
ctcctagaaggtatgacacgattattcgtagaagctggcgaggcttggtcagttgtcatt
tctaaaaaccccgatttttttaaaccaatggttttggtattattgatgttgacctgcaaa
aatgaagacttagatgtcgtttcctatactttccccttttggtttaacttcaaacaaagt
ttagttttgccaagatatcaagaatcaagaaaagcttactctgatatttttgttaaatta
ataaatggtataattactcatttacaatatccatcaggccagttttcatctaaagaggaa
gaagataaatttaaagatttcaggtatcatatgggcgatgtgttaaaagactgtactgca
gtggtgggaacttctgaggctttatcgcaaccactaataagaattaagtccgcaatagaa
aacaacaatagctggcaaataatggaagccccattattttccctgaggactatggctaaa
gaaatttcgttgactgaaaacactatattgccagaaatcattaaaatcatttgtaacctt
ccagagcaggccaagattaggtatgcatcaacattagttcttggtagatataccgaatgg
acagccaagcatccagaactactagaagttcaattgcaatatatttttaacggttttcaa
ctgcatgagggttcatcggatatgcaaagtataatcactgcatcatcacatgcattaatg
ttcttctgttcggactgctctaaactattagttgggtatattgatcagttgattaatttc
ttcctcaacgtgcagagttcgattgatattgagtcacaatttgaactatgtcaaggatta
agtgcagtaataaataatcagccagaggccaaagtttcagtaatatttcaaaagctcgta
gatgataatttgcgacaaatcgaggctttgattcctcaatggaaagcaaatccaacgctc
ttggctccacagattgctgataagattgatttgctatatgcgctttttgaagaattgaaa
ccgagatacaattatcctcagcaaggatcggaacctttactccccaggatagaatttatt
tggaaggcattaagaactctgctagttgatgcaggtgcaatgactgatagtattatcgta
gaaagagtagctaaattgctacgcagaatttttgagagatttcatgtattttgcgagcca
atattaccttctgttgccgaatttctaatccaaggttatttaacgactggattcggttcc
tatctgtggtgttctggttcccttattgttatatttggtgacgatgaatcattccccata
tccccgagtctgaaagatgctgtctggaaatttgccctctcccaatgcgagacgttcata
ctgaatttcaacaagtttgataaacttcaattaaacgattatcatgaggcaataatcgat
tttttctcattaatttcagacttgataatgttttatcctggcgcatttttgaattcaaca
gagcttctaggccccgtactgaatgttgccctcgagtgtgttaataagcttgataactac
gatgcttacatatgtatcttgcgttgcttagatgatatcatatcctgggggttcaagact
ccaccgatctcaacagtgtccatcgagattgttccagatgaatggaggaagcaagttatt
aacgaagtcgtgatagcccacggtaaccaattgatattagtgttattcatcgggctggtt
actacttttgaaaacaccgctcattcagatgccatcagttgtattgtaaaatgtttaagg
atattgacagaggcaaacaacaacgatgccactatttgcatcgattggatttacaaagtg
gtggaacaacttggccaagtaacccttaatgaaagagataatttggcgaaggccgtggtt
gaggggttgaattcaaaggattacagaaaggtgagggaaggaattagggcgtttgttgga
tggtattcaagaaagaatatcaattcgaggtttgaatag

DBGET integrated database retrieval system