KEGG   Saccharomyces cerevisiae (budding yeast): YOR163WHelp
Entry
YOR163W           CDS       T00005                                 

Gene name
DDP1
Definition
(RefSeq) polyphosphatase DDP1
  KO
K07766  diphosphoinositol-polyphosphate diphosphatase [EC:3.6.1.52]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    YOR163W (DDP1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.52  diphosphoinositol-polyphosphate diphosphatase
     YOR163W (DDP1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX
Motif
Other DBs
NCBI-GeneID: 854334
NCBI-ProteinID: NP_014806
SGD: S000005689
UniProt: Q99321
Position
XV:642741..643307
Genome map
AA seq 188 aa AA seqDB search
MGKTADNHGPVRSETAREGRENQVYSPVTGARLVAGCICLTPDKKQVLMITSSAHKKRWI
VPKGGVEKDEPNYETTAQRETWEEAGCIGKIVANLGTVEDMRPPKDWNKDIKQFENSRKD
SEVAKHPPRTEFHFYELEIENLLDKFPECHKRHRKLYSYTEAKQNLIDAKRPELLEALNR
SAIIKDDK
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaaccgcggataatcatggtccagtacgttctgagacagcacgtgaaggaaga
gaaaaccaggtttactcacccgttacaggtgcaagattagttgctggctgcatatgttta
acacccgacaagaagcaagttctcatgattacttcttctgcacacaagaaaagatggatt
gtccccaaaggtggcgttgagaaagacgagcctaattacgagacgactgcccaacgagaa
acttgggaggaagctggttgcataggtaaaattgtcgccaatttgggtacagttgaagac
atgagaccccctaaggactggaacaaagacattaagcaattcgagaactctcgaaaagat
tcagaagtagcaaagcacccgccaagaaccgaatttcatttttatgaattagagattgaa
aatctccttgataaatttccggaatgtcacaaaagacatagaaagctatactcttataca
gaagctaaacaaaacttgatagacgccaagaggcctgaattgttggaggcccttaatagg
tctgctatcattaaagacgacaaatag

DBGET integrated database retrieval system