KEGG   Saccharomyces cerevisiae (budding yeast): YOR164CHelp
Entry
YOR164C           CDS       T00005                                 

Gene name
GET4, ENV8
Definition
(RefSeq) Get4p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF410 DUF2802
Motif
Other DBs
NCBI-GeneID: 854335
NCBI-ProteinID: NP_014807
SGD: S000005690
UniProt: Q12125
Structure
PDB: 

Position
XV:complement(643394..644332)
Genome map
AA seq 312 aa AA seqDB search
MVPAESNAVQAKLAKTLQRFENKIKAGDYYEAHQTLRTIANRYVRSKSYEHAIELISQGA
LSFLKAKQGGSGTDLIFYLLEVYDLAEVKVDDISVARLVRLIAELDPSEPNLKDVITGMN
NWSIKFSEYKFGDPYLHNTIGSKLLEGDFVYEAERYFMLGTHDSMIKYVDLLWDWLCQVD
DIEDSTVAEFFSRLVFNYLFISNISFAHESKDIFLERFIEKFHPKYEKIDKNGYEIVFFE
DYSDLNFLQLLLITCQTKDKSYFLNLKNHYLDFSQAYKSELEFLGQEYFNIVAPKQTNFL
QDMMSGFLGGSK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggttcctgctgaatctaatgctgtacaagcgaaactcgctaaaaccttacaaagattc
gaaaataagatcaaagctggagattattacgaagcgcatcaaacgttgagaactattgct
aatagatatgttagaagtaaatcatacgagcatgccatagaactaattagtcaaggggcc
ctttcatttttaaaggcgaagcagggcggttcaggcacggatttgatcttctatctttta
gaagtttatgatttagcggaagttaaagttgatgacatctcagttgctagattggttaga
ttaatagccgaattggatcctagcgagcccaatttaaaggacgttattactggtatgaac
aattggtctatcaaatttagtgaatacaaatttggagatccttacttgcacaacaccatt
ggtagcaaactattagagggagatttcgtttatgaagctgagagatattttatgttaggt
acacatgattcaatgatcaaatatgtcgatttactatgggactggttatgccaagttgat
gatatcgaagatagcacggtggctgagttcttcagcagattggttttcaactatttattc
atctctaacatatcatttgcacatgaatcaaaagacatttttttggaaagatttattgag
aaatttcaccccaagtacgagaaaattgataaaaatggttatgaaatagttttttttgaa
gattattccgacctaaattttttgcaattgttgctaattacctgtcagactaaggataag
agctatttcttgaatttaaagaaccattatttagatttttctcaagcttacaaaagtgag
ttagaatttttgggccaggaatatttcaatattgttgctcctaaacaaacgaatttccta
caagacatgatgtcgggattcctgggcggatcgaagtga

DBGET integrated database retrieval system