KEGG   Saccharomyces cerevisiae (budding yeast): YOR165WHelp
Entry
YOR165W           CDS       T00005                                 

Gene name
SEY1
Definition
(RefSeq) dynamin-like GTPase SEY1
  KO
K22698  protein SEY1 [EC:3.6.5.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YOR165W (SEY1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.-  
     YOR165W (SEY1)
Membrane trafficking [BR:sce04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Others
    YOR165W (SEY1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RHD3 MMR_HSR1 Dynamin_N Septin Roc
Motif
Other DBs
NCBI-GeneID: 854336
NCBI-ProteinID: NP_014808
SGD: S000005691
UniProt: Q99287
Position
XV:644566..646896
Genome map
AA seq 776 aa AA seqDB search
MADRPAIQLIDEEKEFHQSALQYFQQCIGNRDVGLDYHVISVFGSQSSGKSTLLNVLFNT
NFDTMDAQVKRQQTTKGIWLAHTKQVNTTIEIDNDRPDIFVLDVEGSDGSERGEDQDFER
KAALFAIAVSEVLIVNMWEQQIGLYQGNNMALLKTVFEVNLSLFGKNDNDHKVLLLFVIR
DHVGVTPLSSLSDSVTRELEKIWTELSKPAGCEGSSLYDYFDLKFVGLAHKLLQEDKFTQ
DVKKLGDSFVMKGTENYYFKPQYHHRLPLDGWTMYAENCWDQIERNKDLDLPTQQILVAR
FKTEEISNEALEEFISKYDESIAPLKGNLGSLTSQLVKLKEECLTKYDEQASRYARNVYM
EKREALNTKLNSHISGTINEFLESLMEKLWDDLKLEVSSRDKATTSFVESVAAGKSKIEK
EFNESMETFKKLGLLISNEEITCKFSDDIEERIKQLRDAELKAKIGRIKKNLVPELKDHV
IHLLSHPSKKVWDDIMNDFESTIKDNISAYQVEKDKYDFKIGLSESENAKIYKNIRILAW
RTLDTTVHDYLKIDTIVSILRDRFEDVFRYDAEGSPRLWKTEEEIDGAFRVAKEHALEVF
EVLSLAVTSDNVEIIPDVPMAEEESGEDNEIYRDNEGVFHSRRFAHILTELQKENVLDQF
RRQINITVLDSKRSIITTRTHIPPWIYVLLAVLGWNEFVAVIRNPLFVTLTLILGATFFV
IHKFGLWGPVVNVVQSAVGETRTAIKDKLRQFVVEDHEVKESFEMKDFSKNEQKEK
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atggctgatagacctgctattcagttgatagatgaagagaaggaatttcatcaaagtgca
ttacaatattttcaacaatgtattggaaatcgtgatgttggtctagattaccatgtcatc
tcagttttcggttctcaatcgagtggtaaatcgactttacttaacgtcttgtttaacacc
aactttgataccatggatgctcaggtgaaaaggcagcagactactaaaggcatttggttg
gctcacactaaacaggttaatacaactattgaaatcgataatgatcgtccagatattttt
gtgctagatgttgagggctccgatggttcagaaagaggtgaagaccaagattttgagaga
aaagccgctttatttgccattgcagtatctgaagttcttatagttaatatgtgggagcag
caaattgggctatatcaaggtaataatatggctttattaaaaacagtttttgaggtcaac
ctttccctatttggcaagaatgataatgaccacaaggtgctgttactttttgtaattaga
gatcatgtaggtgtgactccactctcgagtttgagtgattccgttacgagagaattggaa
aaaatatggacagagttaagtaaacctgctggttgtgagggttctagcctgtatgattat
ttcgatttaaagtttgtcgggctagctcataagttgttgcaagaagacaaatttacccag
gatgtcaagaaattaggtgattcgtttgtgatgaaaggtacggaaaactattatttcaaa
cctcaatatcaccataggttgccattagatggttggactatgtacgcagaaaattgttgg
gatcaaattgaacgtaacaaggatttagatcttccaactcagcaaattctggttgctaga
tttaaaactgaagaaatatctaatgaagctctagaagagttcatttcaaaatatgatgaa
tcgattgctcctttaaagggtaacttgggatctttaacatctcagctagtgaagctaaaa
gaagaatgtctgacaaaatatgatgaacaagcatcgcgctatgcaagaaacgtttatatg
gagaaacgagaagctttaaatacaaagctgaattcacatatttcaggtacaattaatgag
ttcttggaatcattaatggaaaagttatgggacgatttaaaattggaggtgtcttctaga
gacaaagctactacctcttttgtagaaagtgtggcggcaggtaagagtaagattgagaaa
gaatttaacgaatcaatggagaccttcaaaaagttagggctactaatatcaaacgaagag
attacctgcaaattttccgacgatattgaagaaagaatcaagcaactacgtgatgctgaa
ttgaaagcaaaaatcggtcgtattaaaaaaaatctggttcccgaattaaaggatcatgtg
attcatttactatcacatccatccaaaaaggtttgggatgatataatgaacgattttgaa
tctactatcaaagacaatatatctgcgtatcaagtggaaaaagataaatatgattttaaa
attggactttcagagagcgaaaacgcgaagatttacaaaaatattagaatattggcgtgg
agaaccttggataccacagtacatgactacctgaaaatagatacgattgttagtatattg
agagacaggtttgaagatgtattcagatatgatgctgaaggttctccaagattgtggaaa
acagaagaagagattgatggggcattccgtgttgcaaaagaacatgccctggaagttttt
gaggttctttcacttgctgtaacctcagataacgttgaaattattcctgatgtaccaatg
gctgaagaggaaagcggcgaggacaacgaaatatatcgggacaacgaaggtgtgtttcat
tcccgtcgtttcgcacacatcttgactgaattgcaaaaggagaatgttttagatcaattc
cgcaggcagattaacattactgttctggattcgaaaaggtctatcatcactactagaacg
catattccaccttggatttacgttttgctagccgtattagggtggaacgaattcgtggct
gtcataagaaaccccttatttgtaacccttaccttgatcttaggtgcaaccttttttgtt
attcataagttcggcctctggggccctgttgttaatgttgttcaaagtgcagttggtgaa
acaagaactgcaataaaggataaactaaggcaatttgtcgttgaagatcatgaagtgaag
gaatcttttgaaatgaaagatttctcaaaaaacgagcaaaaagaaaaatga

DBGET integrated database retrieval system