KEGG   Saccharomyces cerevisiae (budding yeast): YOR168WHelp
Entry
YOR168W           CDS       T00005                                 

Gene name
GLN4
Definition
(RefSeq) glutamine--tRNA ligase
  KO
K01886  glutaminyl-tRNA synthetase [EC:6.1.1.18]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00970  Aminoacyl-tRNA biosynthesis
sce01100  Metabolic pathways
Module
sce_M00359  Aminoacyl-tRNA biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    YOR168W (GLN4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sce01007]
    YOR168W (GLN4)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sce03016]
    YOR168W (GLN4)
Enzymes [BR:sce01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.18  glutamine---tRNA ligase
     YOR168W (GLN4)
Amino acid related enzymes [BR:sce01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   YOR168W (GLN4)
Transfer RNA biogenesis [BR:sce03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    YOR168W (GLN4)
 Prokaryotic Type
   Other AARSs
    YOR168W (GLN4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c tRNA_synt_1c_R1 tRNA-synt_1c_C tRNA_synt_1c_R2
Motif
Other DBs
NCBI-GeneID: 854339
NCBI-ProteinID: NP_014811
SGD: S000005694
UniProt: P13188
Structure
PDB: 

Position
XV:649303..651732
Genome map
AA seq 809 aa AA seqDB search
MSSVEELTQLFSQVGFEDKKVKEIVKNKKVSDSLYKLIKETPSDYQWNKSTRALVHNLAS
FVKGTDLPKSELIVNGIINGDLKTSLQVDAAFKYVKANGEASTKMGMNENSGVGIEITED
QVRNYVMQYIQENKERILTERYKLVPGIFADVKNLKELKWADPRSFKPIIDQEVLKLLGP
KDERDLIKKKTKNNEKKKTNSAKKSSDNSASSGPKRTMFNEGFLGDLHKVGENPQAYPEL
MKEHLEVTGGKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHNGTCYLRFDDTNPEKEAP
EYFESIKRMVSWLGFKPWKITYSSDYFDELYRLAEVLIKNGKAYVCHCTAEEIKRGRGIK
EDGTPGGERYACKHRDQSIEQNLQEFRDMRDGKYKPGEAILRMKQDLNSPSPQMWDLIAY
RVLNAPHPRTGTKWRIYPTYDFTHCLVDSMENITHSLCTTEFYLSRESYEWLCDQVHVFR
PAQREYGRLNITGTVLSKRKIAQLVDEKFVRGWDDPRLFTLEAIRRRGVPPGAILSFINT
LGVTTSTTNIQVVRFESAVRKYLEDTTPRLMFVLDPVEVVVDNLSDDYEELATIPYRPGT
PEFGERTVPFTNKFYIERSDFSENVDDKEFFRLTPNQPVGLIKVSHTVSFKSLEKDEAGK
IIRIHVNYDNKVEEGSKPKKPKTYIQWVPISSKYNSPLRVTETRVYNQLFKSENPSSHPE
GFLKDINPESEVVYKESVMEHNFGDVVKNSPWVVDSVKNSEFYVEEDKDSKEVCRFQAMR
VGYFTLDKESTTSKVILNRIVSLKDATSK
NT seq 2430 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctgtagaagaattgactcagctgttttcacaggttgggtttgaagataaaaag
gtgaaggagattgtcaagaataaaaaggtttctgattcactttacaaattgattaaggag
actccttcggactatcaatggaacaaatctactagagcgctagtacacaacctggcatct
tttgtcaaaggtacagatctacccaagtctgaattaattgttaacggcatcattaatggt
gatttgaagacatctctgcaagtcgatgccgcatttaaatatgtaaaggctaatggcgag
gcatccaccaaaatgggtatgaatgaaaactctggtgttggtattgagattacagaggat
caggttagaaattacgtcatgcagtacattcaagaaaacaaggaaagaattttaactgaa
cgctataaactggtgccaggtatttttgccgatgttaaaaacttaaaggagctgaagtgg
gccgatccacgtagtttcaagccaattatcgaccaagaagtcttaaaacttttgggtcca
aaggatgagagagacttaatcaagaagaagaccaagaataatgaaaagaagaaaaccaat
tctgccaagaagagttctgataattctgcatcatccggtccaaagaggactatgttcaat
gaaggtttcctaggtgatttgcataaagtgggtgaaaacccacaagcttacccagaatta
atgaaggaacaccttgaggttactggtggcaaagttcgtacaaggttccctccggagccc
aatggatatttgcatattggtcattctaaagctattatggttaattttggctatgctaaa
tatcacaatggtacctgttatttaagatttgacgataccaaccccgaaaaggaagctcct
gaatattttgaatccattaagagaatggtttcttggttaggttttaaaccatggaaaatt
acttactcaagtgattattttgacgagctttatcgcctcgctgaagtgttgatcaaaaac
ggcaaagcttacgtttgtcattgtaccgccgaagaaattaaaagaggtcgtggtattaaa
gaagacggtactccaggtggggagagatatgcttgtaagcatcgtgatcagtcgatagaa
caaaacctgcaagaattcagagatatgagagatggcaagtacaaacctggtgaagctatc
ttaagaatgaaacaggatctaaattcaccaagcccacaaatgtgggacttgattgcgtat
agagttttaaatgctccacatccaagaacgggaacaaaatggagaatttatcctacttac
gattttacacattgtttggtcgattcaatggaaaatattacacattctttatgtactact
gaattctacctatctagagaaagctatgaatggttatgtgatcaggttcatgtgttcaga
cccgctcaaagagaatatggtcgtttgaatatcaccggtacagttttatccaaaagaaaa
attgcgcaattggtggatgaaaaattcgttagaggctgggacgatcctagactattcacg
cttgaagctatacgcagacgtggtgttcctcctggtgccattttatcctttatcaacaca
ttaggtgttaccacaagtaccacaaacattcaagttgtgaggtttgagagcgctgttaga
aagtacctagaagataccacaccgagattaatgtttgtgttggatcctgttgaagttgtt
gtcgataatttatctgacgattatgaagaattggcaactattccttacagacctggtact
ccagaatttggtgaaagaactgtaccatttacaaacaaattctacattgaaaggtcagat
ttctcagaaaacgttgatgataaggaatttttcagattaacaccaaaccaaccagttggt
ttaattaaagtctcacacacagtttctttcaaaagtttggaaaaagatgaagctggtaaa
attataagaattcatgtcaactatgataacaaggttgaagaaggttcgaaaccaaagaaa
ccaaaaacttatattcaatgggttcctatctcttcaaaatataattctccattgagagtt
actgaaactagggtttacaaccaattgttcaaatctgaaaatccatcttctcatcctgaa
ggcttcttgaaggacatcaacccagaaagtgaagtcgtttataaagaatctgtcatggaa
cataacttcggggacgttgtcaagaacagtccatgggtcgttgattctgttaaaaactcg
gaattttatgttgaagaagataaggattccaaagaagtgtgtagattccaagctatgaga
gtaggttatttcactctggataaagagagtacgacttctaaggttattttgaatagaata
gttagcttgaaggacgcaacttccaagtga

DBGET integrated database retrieval system