KEGG   Saccharomyces cerevisiae (budding yeast): YOR201CHelp
Entry
YOR201C           CDS       T00005                                 

Gene name
MRM1, PET56
Definition
(RefSeq) Mrm1p
  KO
K15507  21S rRNA (GM2251-2'-O)-methyltransferase [EC:2.1.1.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sce03009]
    YOR201C (MRM1)
Enzymes [BR:sce01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     YOR201C (MRM1)
Ribosome biogenesis [BR:sce03009]
 Eukaryotic Type
  Other ribosome biogenesis factors
   YOR201C (MRM1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SpoU_methylase SpoU_sub_bind
Motif
Other DBs
NCBI-GeneID: 854376
NCBI-ProteinID: NP_014844
SGD: S000005727
UniProt: P25270
Position
XV:complement(720470..721708)
Genome map
AA seq 412 aa AA seqDB search
MTSLTNAVFKRYLAVTPSAHQALKTRIKKKSSSFDKFFPQQSNSRKKQWETLNEDKASWF
KRKYAHVHAREQDRAADPYGKKKAHVEKLKEIKNQAKLNQKSHKSKFQNKDIALKLMNDN
PIFEYVYGTNSVYAALLNPSRNCHSRLLYHGTIPSKFLQIVDELKVTTELVDKHRLNLLT
NYGVHNNIALETKPLQPVEIAYLGDMDTSSAALSIHELGFNNENIPHELPYGTKTDAKKF
PLGLYLDEITDPHNIGAIIRSAYFLGVDFIVMSRRNCSPLTPVVSKTSSGALELLPIFYV
DKPLEFFTKSQEMGGWTFITSHLANATSEKYTVGKTISMHDLNGLCNELPVVLVVGNESQ
GVRTNLKMRSDFFVEIPFGGIEKGNRAPEPIVDSLNVSVATALLIDNILTCK
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgacttccctgactaatgccgtgttcaaacgatacctggcagtgactcctagcgctcac
caagctcttaaaacgagaattaagaaaaagtcgtcatctttcgataagtttttcccacag
caaagcaatagtagaaaaaaacaatgggaaacgttgaatgaagacaaagcgtcgtggttt
aaaaggaaatacgctcacgtacatgctagggaacaggaccgtgcagcggatccatatggc
aagaaaaaggcccacgtcgagaagctaaaggagatcaagaatcaggcgaaattaaaccaa
aagagccataaatccaagttccagaataaggacattgctctgaaacttatgaatgataat
cctatcttcgaatatgtctacggcaccaacagcgtttatgcagcgttgctgaacccgagt
agaaattgccattctcggttgctgtaccatggcactattcctagtaaatttcttcagata
gtcgatgaactgaaggttacgacagagctggtggacaagcacagattaaacttgttgacc
aattacggggtgcacaataacattgctcttgagacaaaacctttgcagcctgtggagatt
gcgtacctaggcgacatggacaccagttcagcagcattaagcattcacgagctgggcttc
aataacgaaaatatacctcatgaactgccttatggtacgaaaacagacgctaagaagttt
cctctcgggttatatctggatgaaataactgaccctcacaatatcggtgccattattaga
agcgcttacttcctgggggttgacttcattgtgatgtcgagaagaaactgctctcctttg
acgcctgtggtgtccaagacaagcagtggggccctcgaacttctgcccatattttacgtt
gataaaccgttagagttttttactaaatcacaagaaatgggtggctggacgtttattaca
agccacttagctaatgccacgtcagaaaaatacactgttggaaaaactattagcatgcac
gatttgaacggattatgtaacgagctgcctgttgttctagtggtggggaacgaaagccag
ggcgtaagaacgaatttgaagatgaggagtgacttcttcgtcgaaattccctttggtggc
attgagaaaggcaatcgggccccagaacccattgttgactcactaaacgtaagcgtggct
actgcattgttaatagataatattctaacttgtaaataa

DBGET integrated database retrieval system