KEGG   Saccharomyces cerevisiae (budding yeast): YOR202WHelp
Entry
YOR202W           CDS       T00005                                 

Gene name
HIS3, HIS10, HIS8
Definition
(RefSeq) imidazoleglycerol-phosphate dehydratase HIS3
  KO
K01693  imidazoleglycerol-phosphate dehydratase [EC:4.2.1.19]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00340  Histidine metabolism
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01230  Biosynthesis of amino acids
Module
sce_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    YOR202W (HIS3)
Enzymes [BR:sce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.19  imidazoleglycerol-phosphate dehydratase
     YOR202W (HIS3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPD
Motif
Other DBs
NCBI-GeneID: 854377
NCBI-ProteinID: NP_014845
SGD: S000005728
UniProt: P06633
Structure
PDB: 

Position
XV:721946..722608
Genome map
AA seq 220 aa AA seqDB search
MTEQKALVKRITNETKIQIAISLKGGPLAIEHSIFPEKEAEAVAEQATQSQVINVHTGIG
FLDHMIHALAKHSGWSLIVECIGDLHIDDHHTTEDCGIALGQAFKEALGAVRGVKRFGSG
FAPLDEALSRAVVDLSNRPYAVVELGLQREKVGDLSCEMIPHFLESFAEASRITLHVDCL
RGKNDHHRSESAFKALAVAIREATSPNGTNDVPSTKGVLM
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgacagagcagaaagccctagtaaagcgtattacaaatgaaaccaagattcagattgcg
atctctttaaagggtggtcccctagcgatagagcactcgatcttcccagaaaaagaggca
gaagcagtagcagaacaggccacacaatcgcaagtgattaacgtccacacaggtataggg
tttctggaccatatgatacatgctctggccaagcattccggctggtcgctaatcgttgag
tgcattggtgacttacacatagacgaccatcacaccactgaagactgcgggattgctctc
ggtcaagcttttaaagaggccctaggggccgtgcgtggagtaaaaaggtttggatcagga
tttgcgcctttggatgaggcactttccagagcggtggtagatctttcgaacaggccgtac
gcagttgtcgaacttggtttgcaaagggagaaagtaggagatctctcttgcgagatgatc
ccgcattttcttgaaagctttgcagaggctagcagaattaccctccacgttgattgtctg
cgaggcaagaatgatcatcaccgtagtgagagtgcgttcaaggctcttgcggttgccata
agagaagccacctcgcccaatggtaccaacgatgttccctccaccaaaggtgttcttatg
tag

DBGET integrated database retrieval system