KEGG   Saccharomyces cerevisiae (budding yeast): YOR206WHelp
Entry
YOR206W           CDS       T00005                                 

Gene name
NOC2
Definition
(RefSeq) mRNA-binding ribosome synthesis protein NOC2
  KO
K14833  nucleolar complex protein 2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sce03009]
    YOR206W (NOC2)
Ribosome biogenesis [BR:sce03009]
 Eukaryotic Type
  Pre-60S particles
   Other pre-60S particles
    YOR206W (NOC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Noc2
Motif
Other DBs
NCBI-GeneID: 854381
NCBI-ProteinID: NP_014849
SGD: S000005732
UniProt: P39744
Position
XV:727512..729644
Genome map
AA seq 710 aa AA seqDB search
MGKVSKSTKKFQSKHLKHTLDQRRKEKIQKKRIQGRRGNKTDQEKADAAGTREQQQLKKS
AKEEVFKDMSVETFFEKGIEIPKENKKLKKKTTKEQSDEDSSSSEEEEDMGQSMAKLAEK
DPEFYKYLEENDKDLLDFAGTNPLDGIDSQDEGEDAERNSNIEEKSEQMELEKEKIELSL
KLVRKWKKQLHDSPSLKLLRNIISAFKVAVNLNKEENIEDYKYAITDEKAFHELMFMVLK
DVPQAIQKMAPYKIVKGARTLPNGGNVSRVSSIVKSHAGSLLILLNDITNTETAALVLHS
VNELMPYLLSYRRILKELIKSIVGVWSTTRELETQIASFAFLINTTKEFKKSMLETTLKT
TYSTFIKSCRKTNMRSMPLINFQKNSAAELFGIDEVLGYQVGFEYIRQLAIHLRNTMNAT
TKKSSKINSAEAYKIVYNWQFCHSLDFWSRVLSFACQPEKENGSESPLRQLIYPLVQVTL
GVIRLIPTPQFFPLRFYLIKSLIRLSQNSGVFIPIYPLLSEILTSTAFTKAPKKSPNLAA
FDFEHNIKCTQAYLNTKIYQEGLSEQFVDLLGDYFALYCKNIAFPELVTPVIISLRRYIK
TSTNVKLNKRLSTVVEKLNQNSTFIQEKRSDVEFGPTNKSEVSRFLNDVAWNKTPLGSYV
AVQREVKEEKARLMRESMEEQDKERETEEAKLLNSLESDDDNEDVEMSDA
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaagtttctaaatcgaccaagaagtttcaatcgaagcatttgaagcatactcta
gaccaaagaagaaaggaaaagatccaaaagaagagaatccaaggccgtcgtggcaacaaa
actgatcaggaaaaggccgatgctgctggtactagggaacaacagcagttgaaaaaatct
gcaaaggaagaggtttttaaggacatgtctgtcgaaactttttttgaaaagggcatcgaa
attccaaaagagaataaaaaattgaagaaaaaaactacgaaagagcaatctgatgaagat
tcctcctcttccgaagaggaggaagacatgggacaaagcatggcaaagttggccgaaaag
gatcccgaattttataagtatttggaggaaaatgataaagatttattggacttcgcaggt
accaatccattggatggaattgatagtcaagatgaaggtgaagatgctgaaagaaacagt
aatattgaagaaaaatctgaacaaatggagctggaaaaggaaaaaattgagctttctttg
aaattggttaggaaatggaaaaaacaacttcatgattctccaagcttaaaattactaagg
aacataatcagtgctttcaaggttgctgtaaatttgaacaaggaagaaaacatcgaagac
tataaatatgctatcactgatgagaaagcattccacgaattgatgttcatggtcttgaaa
gatgtaccacaagcgattcaaaagatggccccatacaagattgtaaaaggcgcaaggacc
ttaccaaatggaggtaacgtctccagggtctcgtccattgtcaagtcgcatgctggctct
ttgttgattttattgaatgatattactaatacggaaacagcagcattagttcttcattct
gtcaacgaattgatgccttatcttttatcatacagaaggatcttaaaggagcttattaaa
tcaattgttggagtatggtctacaacgagagaattagaaacccagattgcttcttttgcc
tttttgatcaataccaccaaagagttcaagaagtctatgctagaaacaaccttaaaaaca
acgtactccacttttatcaaaagttgtcgtaaaacgaatatgcgttctatgccactgatt
aattttcaaaaaaattcggcagctgaattgttcggtatcgatgaagttctaggttaccaa
gttggatttgagtatattaggcaattggcaattcatttaagaaatacaatgaacgcgaca
actaaaaaatccagtaaaattaattccgcagaagcttacaagattgtatacaactggcaa
ttctgtcactccttggatttctggtctcgtgtactatcgtttgcttgtcaaccagaaaag
gaaaatggcagtgaatctcctttacgacaattaatttacccattggttcaggttactttg
ggtgtaatcagattaatcccaacaccacaattcttcccattaagattttatttgattaaa
tcacttattagactttctcaaaatagtggtgtttttattccaatatatcctttactttct
gaaattttaacctcaacggctttcactaaggcacccaaaaagagccctaacttggctgct
ttcgattttgagcacaacatcaaatgtacgcaagcttatctgaatacaaaaatataccaa
gagggtttgtcagaacagtttgtggacttattgggcgattattttgctctgtactgtaaa
aacattgcatttcctgaacttgtaacaccggttattatctctttacgccgttacatcaag
acttcaactaatgtcaaacttaacaaacgtttatcaactgttgtagaaaaattgaaccaa
aacagcacattcatccaagaaaagagatcagatgttgaatttgggccaacaaacaaatct
gaagtttcaagatttttgaatgatgtagcttggaataaaacacctttaggttcttatgtt
gcagtacaacgtgaagttaaggaagaaaaggccagattaatgagagaaagtatggaagaa
caagacaaagaaagagaaacagaagaagcaaaattattaaacagtctggaaagtgatgat
gacaacgaagatgttgaaatgtcagacgcttaa

DBGET integrated database retrieval system