KEGG   Saccharomyces cerevisiae (budding yeast): YOR209CHelp
Entry
YOR209C           CDS       T00005                                 

Gene name
NPT1
Definition
(RefSeq) nicotinate phosphoribosyltransferase
  KO
K00763  nicotinate phosphoribosyltransferase [EC:6.3.4.21]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00760  Nicotinate and nicotinamide metabolism
sce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    YOR209C (NPT1)
Enzymes [BR:sce01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.21  nicotinate phosphoribosyltransferase
     YOR209C (NPT1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAPRTase NAPRTase_N
Motif
Other DBs
NCBI-GeneID: 854384
NCBI-ProteinID: NP_014852
SGD: S000005735
UniProt: P39683
Structure
PDB: 

Position
XV:complement(736437..737726)
Genome map
AA seq 429 aa AA seqDB search
MSEPVIKSLLDTDMYKITMHAAVFTNFPDVTVTYKYTNRSSQLTFNKEAINWLKEQFSYL
GNLRFTEEEIEYLKQEIPYLPSAYIKYISSSNYKLHPEEQISFTSEEIEGKPTHYKLKIL
VSGSWKDTILYEIPLLSLISEAYFKFVDIDWDYENQLEQAEKKAETLFDNGIRFSEFGTR
RRRSLKAQDLIMQGIMKAVNGNPDRNKSLLLGTSNILFAKKYGVKPIGTVAHEWVMGVAS
ISEDYLHANKNAMDCWINTFGAKNAGLALTDTFGTDDFLKSFRPPYSDAYVGVRQDSGDP
VEYTKKISHHYHDVLKLPKFSKIICYSDSLNVEKAITYSHAAKENGMLATFGIGTNFTND
FRKKSEPQVKSEPLNIVIKLLEVNGNHAIKISDNLGKNMGDPATVKRVKEELGYTERSWS
GDNEAHRWT
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaccagtgataaagtctcttttggacacagacatgtacaagattacgatgcat
gctgctgtcttcactaattttccagatgttacagttacttataaatataccaacaggtcg
tcccaattgaccttcaataaggaagccattaattggttgaaagagcaattttcgtatttg
ggaaatttgaggttcacagaagaggaaattgaatacttaaaacaggaaatcccatatttg
ccatcggcatatattaagtatattagcagttctaattacaaactacaccctgaagagcag
atttccttcacttcagaagaaatcgagggcaagcccacccactacaaattgaaaatttta
gtcagtggtagttggaaggatactatcctttatgagatccccttactgtccctaatatca
gaagcgtattttaaatttgttgacatcgactgggactacgaaaaccaattagaacaagct
gagaagaaggcggaaactttgtttgataatggtattagattcagtgaatttggtacaaga
cgtcgtagatctctgaaggctcaagatctaattatgcaaggaatcatgaaagctgtgaac
ggtaacccagacagaaacaaatcgctattattaggcacatcaaatattttatttgccaag
aaatatggagtcaagccaatcggtactgtggctcacgagtgggttatgggagtcgcttct
attagtgaagattatttgcatgccaataaaaatgcaatggattgttggatcaatactttt
ggtgcaaaaaatgctggtttagcattaacggatacttttggaactgatgactttttaaaa
tcattccgtccaccatattctgatgcttacgtcggtgttagacaagattctggagaccca
gttgagtataccaaaaagatttcccaccattaccatgacgtgttgaaattgcctaaattc
tcgaagattatctgttattccgattctttgaacgtcgaaaaggcaataacttactcccat
gcagctaaagagaatggaatgctagccacattcggtattggcacaaactttactaatgat
tttcgtaagaagtcagaaccccaggttaaaagtgagccgttaaacatcgttatcaaacta
ttagaagtaaatggtaatcacgctatcaaaatttctgataacttaggtaaaaatatggga
gatcctgccactgtgaagagagtgaaagaggaattgggatatactgaacgaagttggagt
ggtgataacgaagcgcacagatggacctaa

DBGET integrated database retrieval system