KEGG   Saccharomyces cerevisiae (budding yeast): YOR222W
Entry
YOR222W           CDS       T00005                                 

Gene name
ODC2
Definition
(RefSeq) mitochondrial 2-oxodicarboxylate carrier
  KO
K15110  solute carrier family 25 (mitochondrial 2-oxodicarboxylate transporter), member 21
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YOR222W (ODC2)
Transporters [BR:sce02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   YOR222W (ODC2)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 854397
NCBI-ProteinID: NP_014865
SGD: S000005748
UniProt: Q99297
Position
XV:758330..759253
AA seq 307 aa
MSSDSNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYN
GVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKI
SIAAGASAGMTEAAVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTM
WRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQ
SVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFF
RDLKYGH
NT seq 924 nt   +upstreamnt  +downstreamnt
atgtcatcagactcaaacgcaaagccattgccttttatatatcagttcatatcaggtgcc
gtcgccggtatttctgagttaactgttatgtatccgcttgatgttgttaagacaagattt
caactggaggtgacgacgcctactgccgctgcagtaggaaagcaagtagagagatataat
ggtgtcatcgattgtttgaaaaaaattgtaaagaaggaagggtttagcagactttacaga
ggtattagttcaccaatgttgatggaagcaccaaagagagccaccaaatttgcatgtaac
gatcaatatcaaaaaatcttcaaaaacctattcaacacgaatgaaactacgcagaagatc
tccattgcggctggtgcatctgctggtatgacagaagctgcagttattgttccatttgaa
ttgatcaaaatcaggatgcaagacgtcaagtccagctatcttggaccaatggactgtttg
aaaaaaacaatcaaaaacgaaggtattatggggctatacaagggtatcgaatctaccatg
tggagaaacgctctttggaatggtggctacttcggtgttatctaccaagtgagaaattcc
atgcccgtagcaaagacaaagggacaaaagaccagaaatgaccttattgcaggtgcgatc
ggtggtacggtcgggaccatgcttaacactccctttgacgtggtgaaatccagaatccaa
agtgtggacgcggtcagcagtgctgttaaaaaatacaactggtgcctaccttcgctattg
gtcatataccgtgaagaaggcttcagagcattgtacaaaggtttcgtccccaaagtatgt
agactagcacccggtggttcattaatgttggtggtttttaccggtatgatgaactttttc
agggatctgaagtacggacactga

DBGET integrated database retrieval system