KEGG   Saccharomyces cerevisiae (budding yeast): YOR245C
Entry
YOR245C           CDS       T00005                                 

Symbol
DGA1
Name
(RefSeq) diacylglycerol O-acyltransferase
  KO
K14457  2-acylglycerol O-acyltransferase 2 [EC:2.3.1.22]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00561  Glycerolipid metabolism
sce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    YOR245C (DGA1)
Enzymes [BR:sce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.22  2-acylglycerol O-acyltransferase
     YOR245C (DGA1)
SSDB
Motif
Pfam: DAGAT
Other DBs
NCBI-GeneID: 854419
NCBI-ProteinID: NP_014888
SGD: S000005771
UniProt: Q08650
Position
XV:complement(794076..795332)
AA seq 418 aa
MSGTFNDIRRRKKEEGSPTAGITERHENKSLSSIDKREQTLKPQLESCCPLATPFERRLQ
TLAVAWHTSSFVLFSIFTLFAISTPALWVLAIPYMIYFFFDRSPATGEVVNRYSLRFRSL
PIWKWYCDYFPISLIKTVNLKPTFTLSKNKRVNEKNYKIRLWPTKYSINLKSNSTIDYRN
QECTGPTYLFGYHPHGIGALGAFGAFATEGCNYSKIFPGIPISLMTLVTQFHIPLYRDYL
LALGISSVSRKNALRTLSKNQSICIVVGGARESLLSSTNGTQLILNKRKGFIKLAIQTGN
INLVPVFAFGEVDCYNVLSTKKDSVLGKMQLWFKENFGFTIPIFYARGLFNYDFGLLPFR
APINVVVGRPIYVEKKITNPPDDVVNHFHDLYIAELKRLYYENREKYGVPDAELKIVG
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgtcaggaacattcaatgatataagaagaaggaagaaggaagaaggaagccctacagcc
ggtattaccgaaaggcatgagaataagtctttgtcaagcatcgataaaagagaacagact
ctcaaaccacaactagagtcatgctgtccattggcgaccccttttgaaagaaggttacaa
actctggctgtagcatggcacacttcttcatttgtactcttctccatatttacgttattt
gcaatctcgacaccagcactgtgggttcttgctattccatatatgatttatttttttttc
gataggtctcctgcaactggcgaagtggtaaatcgatactctcttcgatttcgttcattg
cccatttggaagtggtattgtgattatttccctataagtttgattaaaactgtcaattta
aaaccaacttttacgctttcaaaaaataagagagttaacgaaaaaaattacaagattaga
ttgtggccaactaagtattccattaatctcaaaagcaactctactattgactatcgcaac
caggaatgtacagggccaacgtacttatttggttaccatccacacggcataggagcactt
ggtgcgtttggagcgtttgcaacagaaggttgtaactattccaagattttcccaggtatt
cctatttctctgatgacactggtcacacaatttcatatcccattgtatagagactactta
ttggcgttaggtatttcttcagtatctcggaaaaacgctttaaggactctaagcaaaaat
cagtcgatctgcattgttgttggtggcgctagggaatctttattaagttcaacaaatggt
acacaactgattttaaacaaaagaaagggttttattaaactggccattcaaacggggaat
attaacctagtgcctgtgtttgcatttggagaggtggactgttataatgttctgagcaca
aaaaaagattcagtcctgggtaaaatgcaactatggttcaaagaaaactttggttttacc
attcccattttctacgcaagaggattattcaattacgatttcggtttgttgccatttaga
gcgcctatcaatgttgttgttggaaggcctatatacgttgaaaagaaaataacaaatccg
ccagatgatgttgttaatcatttccatgatttgtatattgcggagttgaaaagactatat
tacgaaaatagagaaaaatatggggtaccggatgcagaattgaagatagttgggtaa

DBGET integrated database retrieval system