KEGG   Saccharomyces cerevisiae (budding yeast): YOR280CHelp
Entry
YOR280C           CDS       T00005                                 

Gene name
FSH3
Definition
(RefSeq) putative serine hydrolase
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FSH1 Peptidase_S15 Abhydrolase_2 Hydrolase_4
Motif
Other DBs
NCBI-GeneID: 854454
NCBI-ProteinID: NP_014923
SGD: S000005806
UniProt: Q99369
Position
XV:complement(844992..845792)
Genome map
AA seq 266 aa AA seqDB search
MSEKKKVLMLHGFVQSDKIFSAKTGGLRKNLKKLGYDLYYPCAPHSIDKKALFQSESEKG
RDAAKEFNTSATSDEVYGWFFRNPESFNSFQIDQKVFNYLRNYVLENGPFDGVIGFSQGA
GLGGYLVTDFNRILNLTDEQQPALKFFISFSGFKLEDQSYQKEYHRIIQVPSLHVRGELD
EVVAESRIMALYESWPDNKRTLLVHPGAHFVPNSKPFVSQVCNWIQGITSKEGQEHNAQP
EVDRKQFDKPQLEDDLLDMIDSLGKL
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaaagaagaaagttctaatgctacatggttttgtccaatccgataagatattt
tctgcgaagactggaggattacgaaagaatttgaagaagttaggttacgatttatactat
ccttgcgccccacattcaattgataaaaaagcgttattccaatcagagtcagaaaagggt
agagatgctgcgaaggaattcaacacctcagcgactagtgatgaagtatacgggtggttc
tttagaaatcccgaatctttcaattcctttcaaatagatcaaaaggtgtttaactattta
cgtaactacgtgctagaaaatggaccatttgatggtgtcattggattcagccaaggtgca
ggtcttgggggctacttagtcactgactttaacagaatattaaatcttactgatgaacaa
cagcccgctttaaaattttttatttcatttagtggattcaaattagaagatcaatcctac
cagaaagaatatcataggattatccaggtgccctctctacatgtaaggggggagttagat
gaagttgtagcagaatctagaatcatggcattgtacgagtcatggcccgataacaaaagg
acattgttggttcatcctggagcccattttgtcccaaactcgaaaccattcgtatcccaa
gtttgcaattggatccaaggaattactagcaaagagggtcaagagcataatgcccaacct
gaagtagatcggaaacaatttgacaaacctcaattggaagatgatttgttagatatgatc
gattccttgggtaaattgtaa

DBGET integrated database retrieval system