KEGG   Saccharomyces cerevisiae (budding yeast): YOR281CHelp
Entry
YOR281C           CDS       T00005                                 

Gene name
PLP2
Definition
(RefSeq) Plp2p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosducin RUN
Motif
Other DBs
NCBI-GeneID: 854456
NCBI-ProteinID: NP_014924
SGD: S000005807
UniProt: Q12017
Position
XV:complement(846269..847129)
Genome map
AA seq 286 aa AA seqDB search
MQNEPMFQVQVDESEDSEWNDILRAKGVIPERAPSPTAKLEEALEEAIAKQHENRLEDKD
LSDLEELEDDEDEDFLEAYKIKRLNEIRKLQERSKFGEVFHINKPEYNKEVTLASQGKKY
EGAQTNDNGEEDDGGVYVFVHLSLQSKLQSRILSHLFQSAACKFREIKFVEIPANRAIEN
YPESNCPTLIVYYRGEVIKNMITLLELGGNNSKMEDFEDFMVKVGAVAEGDNRLIMNRDD
EESREERKLHYGEKKSIRSGIRGKFNVGIGGNDDGNINDDDDGFFD
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgcagaatgaaccaatgtttcaggtccaggtggacgaatctgaagacagtgaatggaac
gatattttaagagcgaagggtgtaataccagaacgtgcaccttcgcccactgcaaagtta
gaagaagcattagaagaagcaattgccaagcagcatgaaaatagactagaagataaagac
ttgtcggatttggaagaactagaagacgatgaagatgaagatttcttggaagcttacaag
atcaaaagattaaatgaaatccgcaaattacaggaacgttccaaatttggagaagttttc
cacattaacaaacctgaatacaacaaagaggttactttggccagtcagggaaagaaatat
gaaggtgcacaaaccaatgacaatggtgaagaggatgacggtggtgtctacgtattcgtt
catctctcgcttcaaagtaaactacaaagcagaattctgtctcatcttttccaatctgct
gcatgcaaattcagagaaataaaatttgtagaaatacctgccaatagagcaattgaaaac
tatcccgaatccaattgcccgacattaattgtatattaccggggtgaggtaatcaaaaac
atgataacgctactagaactgggtggtaataattccaagatggaagactttgaagatttt
atggtaaaagttggcgctgttgcagaaggagacaacagactgataatgaaccgagacgat
gaagaatccagggaagagagaaaattgcattacggtgaaaaaaaatcgatcaggtcaggt
attagaggaaaatttaatgtcggcataggtggaaatgatgatggcaacattaatgatgat
gatgatggattttttgactaa

DBGET integrated database retrieval system