KEGG   Saccharomyces cerevisiae (budding yeast): YOR283WHelp
Entry
YOR283W           CDS       T00005                                 

Definition
(RefSeq) phosphoglycerate mutase
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 854457
NCBI-ProteinID: NP_014926
SGD: S000005809
UniProt: Q12040
Position
XV:847453..848145
Genome map
AA seq 230 aa AA seqDB search
MTKEVPYYCDNDDNNIIRLFIIRHGQTEHNVKKILQGHKDTSINPTGEEQATKLGHYLRS
RGIHFDKVVSSDLKRCRQTTALVLKHSKQENVPTSYTSGLRERYMGVIEGMQITEAEKYA
DKHGEGSFRNFGEKSDDFVARLTGCVEEEVAEASNEGVKNLALVSHGGAIRMILQWLKYE
NHQAHKIIVFNTSVTIVDYVKDSKQFIVRRVGNTQHLGDGEFVVSDLRLR
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgactaaggaagtaccatattattgcgataatgacgataacaacatcatcagattattc
attattaggcatggacaaacagaacacaatgtaaaaaaaattttgcaaggtcacaaagat
acctcgatcaatcctacgggagaagaacaagccactaaattggggcattacttgcgttca
agaggtattcattttgataaggttgtcagtagtgatttaaaaaggtgtaggcaaactacg
gctttagttttgaaacattcaaaacaagaaaatgtgcctacttcctatacttcggggtta
agggagcgttatatgggtgttattgaaggtatgcagattactgaggctgaaaagtatgct
gataaacatggtgaaggctcctttagaaattttggggaaaaaagtgacgattttgttgct
aggttaactggatgtgtcgaagaagaagttgctgaagcatctaatgaaggtgtcaagaat
ctagccctagttagtcatggaggtgctatcagaatgattttacaatggttaaagtatgaa
aatcatcaagctcataagatcattgttttcaacacctctgtcactatagttgattacgtc
aaggactccaagcagtttattgtgagacgtgtcggaaacacccaacatcttggtgatggc
gaatttgtcgtcagtgacttaagattacgttag

DBGET integrated database retrieval system