KEGG   Saccharomyces cerevisiae (budding yeast): YOR285WHelp
Entry
YOR285W           CDS       T00005                                 

Gene name
RDL1
Definition
(RefSeq) thiosulfate sulfurtransferase RDL1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rhodanese
Motif
Other DBs
NCBI-GeneID: 854459
NCBI-ProteinID: NP_014928
SGD: S000005811
UniProt: Q12305
Structure
PDB: 

Position
XV:849635..850054
Genome map
AA seq 139 aa AA seqDB search
MWKAVMNAWNGTESQSKNVSNIQSYSFEDMKRIVGKHDPNVVLVDVREPSEYSIVHIPAS
INVPYRSHPDAFALDPLEFEKQIGIPKPDSAKELIFYCASGKRGGEAQKVASSHGYSNTS
LYPGSMNDWVSHGGDKLDL
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaggccgtgatgaatgcttggaatggaaccgagagtcaaagtaagaatgtttca
aatattcaatcttacagttttgaagacatgaaaagaatcgttggaaagcatgatcctaat
gtggttttggtagatgttagagaaccatctgagtactcgattgttcatattcctgcttcc
atcaatgtgccatatagatcgcaccctgacgcatttgccttagatcctttagaatttgag
aaacagattggcatcccaaaacctgacagtgccaaggagctaatattttattgtgcttct
ggcaaacgcgggggagaagctcaaaaagtcgcctcctcacatggatattcaaacacctca
ctatatcctggctctatgaatgattgggtttctcatgggggtgataaacttgacttatag

DBGET integrated database retrieval system