KEGG   Saccharomyces cerevisiae (budding yeast): YOR287CHelp
Entry
YOR287C           CDS       T00005                                 

Gene name
RRP36
Definition
(RefSeq) rRNA-processing protein RRP36
  KO
K14795  ribosomal RNA-processing protein 36
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sce03009]
    YOR287C (RRP36)
Ribosome biogenesis [BR:sce03009]
 Eukaryotic Type
  90S particles
   Other 90S particles
    YOR287C (RRP36)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RRP36
Motif
Other DBs
NCBI-GeneID: 854461
NCBI-ProteinID: NP_014930
SGD: S000005813
UniProt: Q12481
Position
XV:complement(850937..851839)
Genome map
AA seq 300 aa AA seqDB search
MSYYFKNLKPDLNSDVEEDDGNLLESIMANKSKREIDEQESSDDELKTLSFGSLKKAETV
IDEEDFKDTKPVHKKPITTTYREESFDEDEDSEDQSDEDAGFFEEDSEDETHHGQKVPKK
KSKHAPVEQSSKKRVPRVRNIPGLEIPRNKRSNLYQDIRFDKSTGKALDSSIIRKRYQFL
DEYREKEIDELQKLLQERKFLSKIDQGEREEMEQRLKSMKSRLQSMKNKDLEREILKEYE
NDMNKNNNTRYHLKKSEKRKVVQKWKFDHMKAKQREKVMERKRKKRLGKEFKQFEFHNRR
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtattactttaaaaatctgaagccagacttgaactccgacgtagaagaagatgac
ggaaacttattggagagcataatggcgaacaaaagtaagcgagaaattgacgaacaagaa
tcaagtgacgatgagttgaaaaccttgtcttttggttctttgaagaaggctgaaacggta
atagatgaagaagatttcaaagatacgaaacccgttcacaaaaaaccgatcacaactaca
tacagagaagaaagttttgatgaagatgaggacagtgaggaccaatcagacgaggatgct
ggattctttgaagaagatagtgaggatgaaactcatcatggtcagaaagtaccaaaaaag
aagagcaaacacgctccagtagaacaatcatccaagaaaagggtaccacgagtccgaaat
atccctgggctggaaataccgaggaataaaaggtctaacctctatcaggacatcagattt
gataagtccaccggtaaagcccttgatagttctatcataagaaaacgttaccagttcttg
gacgaatatagagaaaaagaaattgatgaactgcagaagctgttacaagaaagaaaattt
ctatcaaaaatagaccagggagaacgtgaagaaatggaacaaagactgaaaagtatgaaa
tcgagattgcaatcaatgaaaaacaaagatctcgagcgtgaaattctcaaggaatacgaa
aatgatatgaataaaaacaataatacgagataccatttgaaaaagtctgagaaacgtaaa
gtggtgcaaaagtggaaatttgatcacatgaaggccaagcaacgtgaaaaggtcatggaa
aggaaaaggaagaagagattgggtaaagagtttaaacaatttgaatttcataatcgtagg
tag

DBGET integrated database retrieval system