KEGG   Saccharomyces cerevisiae (budding yeast): YOR288CHelp
Entry
YOR288C           CDS       T00005                                 

Gene name
MPD1
Definition
(RefSeq) protein disulfide isomerase MPD1
  KO
K09584  protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    YOR288C (MPD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:sce03110]
    YOR288C (MPD1)
   04131 Membrane trafficking [BR:sce04131]
    YOR288C (MPD1)
Enzymes [BR:sce01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     YOR288C (MPD1)
Chaperones and folding catalysts [BR:sce03110]
 Protein folding catalysts
  Protein disulfide isomerase
   YOR288C (MPD1)
Membrane trafficking [BR:sce04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    YOR288C (MPD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_8 Thioredoxin_2 Thioredoxin_7 OST3_OST6 Thioredoxin_3 TraF AhpC-TSA
Motif
Other DBs
NCBI-GeneID: 854462
NCBI-ProteinID: NP_014931
SGD: S000005814
UniProt: Q12404
Structure
PDB: 

Position
XV:complement(852121..853077)
Genome map
AA seq 318 aa AA seqDB search
MLFLNIIKLLLGLFIMNEVKAQNFYDSDPHISELTPKSFDKAIHNTNYTSLVEFYAPWCG
HCKKLSSTFRKAAKRLDGVVQVAAVNCDLNKNKALCAKYDVNGFPTLMVFRPPKIDLSKP
IDNAKKSFSAHANEVYSGARTLAPIVDFSLSRIRSYVKKFVRIDTLGSLLRKSPKLSVVL
FSKQDKISPVYKSIALDWLGKFDFYSISNKKLKQLTDMNPTYEKTPEIFKYLQKVIPEQR
QSDKSKLVVFDADKDKFWEYEGNSINKNDISKFLRDTFSITPNEGPFSRRSEYIAYLKTG
KKPIKKNHSSSGNKHDEL
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgttatttcttaatattattaagctccttttgggactttttattatgaatgaagtaaag
gcgcaaaacttttacgattccgatcctcatatatcagagttaacgccaaaaagcttcgat
aaagcgatccataacacaaattacacatcattagtggaattttatgctccgtggtgcggc
cattgtaagaagctctctagtacgttccgcaaggcagcaaaaagattggatggtgtagtc
caagttgctgctgtaaactgtgaccttaacaagaataaggctttgtgtgctaaatacgac
gtaaacggatttcccacgttaatggtatttaggcccccaaaaattgacctatctaagcca
atagataacgccaaaaaaagtttcagcgctcatgccaatgaagtgtactcaggtgcaaga
actctcgcgcctattgttgatttttctctttcaagaataaggtcatatgtcaaaaagttt
gtccgtatagatacacttggctctttacttagaaagtcacccaaactttccgtggtgttg
ttttccaaacaagacaaaatttcaccggtttataaaagcattgcccttgattggttagga
aagttcgatttttattcaatttcaaacaaaaaactcaagcaactaaccgatatgaaccca
acatatgaaaaaactcctgagattttcaaatatttgcagaaggtcattcctgaacagcga
cagagcgataaaagtaagcttgtcgtttttgatgcagacaaagataaattttgggagtat
gaagggaactcaatcaacaaaaatgacatttccaaatttctgcgggacacttttagtatt
acccccaatgagggtccttttagtagacgttctgaatatattgcttacttaaaaactggc
aagaagccaattaaaaagaaccattcctcctcaggaaacaagcacgacgaattgtag

DBGET integrated database retrieval system