KEGG   Saccharomyces cerevisiae (budding yeast): YOR289WHelp
Entry
YOR289W           CDS       T00005                                 

Definition
(RefSeq) hypothetical protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMMECR1
Motif
Other DBs
NCBI-GeneID: 854463
NCBI-ProteinID: NP_014932
SGD: S000005815
UniProt: Q12012
Position
XV:853357..854112
Genome map
AA seq 251 aa AA seqDB search
MALRLFRKSSFFAKISMEGPKGSSPFAFYAFYQLYSHLNPGKSSSLSLEDIRRRLYPDFK
IDYNEKTSLFITWKKKSNKHHTIDTNEENYILRGCIGTFAKMPIAHGIEKYSLIAALEDR
RFSPIQKRELVDLKCSCNILGNFKTIFRGGGNPNGDIFDWELGKHGIELYFKHPKTGTTC
SATFLPDVMPEQHWNKEDTFANLIEKAGYWGNISEVMDNFETYFIEVIRYEGKKSSITYE
EFNKQLKDIEA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggctttaaggctatttcgaaaatccagtttttttgcaaagatatcaatggaaggccct
aaaggttcatcgccatttgcgttttacgcattttatcaactttattcgcacttgaatccg
gggaaatcgagcagcctttctttagaagatattagaagaaggctataccccgactttaaa
atagattacaatgagaaaacttcgttgttcataacttggaagaaaaagtccaataaacat
cacacaatagacactaacgaagagaattatatacttagaggatgtatcggtacatttgct
aagatgccgattgcacatggtattgagaaatattccttgattgctgctttagaggatagg
agattttctccgatccagaaaagggaattggtggacctgaaatgcagttgcaacatctta
ggcaacttcaaaactatttttcgaggtggtggtaatccaaatggggacattttcgattgg
gaactcggaaagcacggtattgaactgtattttaagcatcccaaaacaggcaccacatgt
agcgcaacctttttacctgatgttatgcctgagcaacattggaataaagaagataccttt
gccaatttaatcgagaaggcgggttactggggcaatattagtgaagtaatggataatttt
gaaacttatttcattgaagtaataaggtacgagggcaaaaaaagttccataacttatgag
gaatttaacaaacagttaaaagatatagaggcttag

DBGET integrated database retrieval system