KEGG   Saccharomyces cerevisiae (budding yeast): YOR291W
Entry
YOR291W           CDS       T00005                                 

Gene name
YPK9
Definition
(RefSeq) putative acid anhydride hydrolase
  KO
K13526  cation-transporting P-type ATPase 13A2 [EC:7.2.2.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    YOR291W (YPK9)
Motif
Pfam: P5-ATPase E1-E2_ATPase Hydrolase Cation_ATPase Cation_ATPase_N
Other DBs
NCBI-GeneID: 854466
NCBI-ProteinID: NP_014934
SGD: S000005817
UniProt: Q12697
Position
XV:861175..865593
AA seq 1472 aa
MDIPSSNQIQHGQRSERNRRMPRASFSSTATTSTAATLTSAMVLDQNNSEPYAGATFEAV
PSSIVSFHHPHSFQSSNLPSPHSSGNLEQRGRRLTESEPLVLSSAEQSRSSSRNPSHFRF
FTQEQISNAEGASTLENTDYDMAWDATPAYEQDRIYGTGLSSRRSSIRSFSRASSLSNAK
SYGSFSKRGRSGSRAPQRLGENSDTGFVYHSATHSSSSLSRYTTRERIPIELESQTDEIL
EDESSTHSLESSDSRRSASENNRGSFSGHDDVHNQHSEYLKPDYHEKFYPQYAPNLHYQR
FYIAEEDLVIGIAAYQTSKFWYIIYNLCCFLTFGLVYLLTRWLPHLKVKLYGVKVPLAKA
EWVVIENEFGEFVIQPIDRQWYNRPLSTVLPFENYPNPSYEPNDINLSHHHANEINPNVP
ILITFEYRYIKFIYSPLDDLFKTNNNWIDPDWVDLSTVSNGLTKGVQEDRELAFGKNQIN
LRMKTTSEILFNEVLHPFYVFQVFSIILWGIDEYYYYAACIFLISVLSIFDSLNEQKKVS
RNLAEMSHFHCDVRVLRDKFWTTISSSELVPGDIYEVSDPNITILPCDSILLSSDCIVNE
SMLTGESVPVSKFPATEETMYQLCDDFQSTQISSFVSKSFLYNGTNIIRARIAPGQTAAL
AMVVRTGFSTTKGSLVRSMVFPKPTGFKFYRDSFKYIGFMSLIAIFGFCVSCVQFIKLGL
DKKTMILRALDIITIVVPPALPATLTIGTNFALSRLKEKGIFCISPTRLNISGKIDVMCF
DKTGTLTEDGLDVLGVQISEPNGVRGQKFGELLSDIRQVFPKFSLNDCSSPLDFKSRNFF
MSLLTCHSLRSVDGNLLGDPLDFKMFQFTGWSFEEDFQKRAFHSLYEGRHEDDVFPENSE
IIPAVVHPDSNNRENTFTDNDPHNFLGVVRSFEFLSELRRMSVIVKTNNDDVYWSFTKGA
PEVISEICNKSTLPADFEEVLRCYTHNGYRVIACAGKTLPKRTWLYSQKVSREEVESNLE
FLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVYVPSI
NDTPLHGEPVIVWRDVNEPDKILDTKTLKPVKLGNNSVESLRECNYTLAVSGDVFRLLFR
DENEIPEEYLNEILLNSSIYARMSPDEKHELMIQLQKLDYTVGFCGDGANDCGALKAADV
GISLSEAEASVAAPFTSKIFNISCVLDVIREGRAALVTSFACFQYMSLYSAIQFITITIL
YSRGSNLGDFQFLYIDLLLIVPIAICMSWSKSYEKIDKKRPSANLVSPKILVPLLISVFL
VFLFQFIPWIIVQKMSWYIKPIVGGDDAVQSSDNTVLFFVSNFQYILTAIVLSVGPPYRE
PMSKNFEFIVDITVSIGASLLLMTLDTESYLGKMLQLTPISNSFTMFIIVWVILNYYAQL
YIPPSIKGWLKKKKSSKKYKLLIQEEMKLKEV
NT seq 4419 nt   +upstreamnt  +downstreamnt
atggatattccctcttcaaaccaaattcaacatggccaaaggagtgaaaggaaccgaaga
atgccgagggcttctttttcttctacagccactacttctacggcggccacattgacttcc
gcgatggtactggatcagaacaattcggaaccgtacgcaggtgcaacattcgaagccgtg
ccaagttctattgtatcattccatcaccctcattcttttcaatcaagcaacctcccaagt
ccgcattcttcagggaacctagagcagagaggccgccgattgactgaatcagagccttta
gtattatcctcggctgaacagtctcgaagctcttctagaaacccttctcattttcgattt
ttcactcaggagcaaatatccaatgctgaaggcgcttccacgttagaaaatacagattat
gacatggcctgggatgccacccccgcttatgaacaagatagaatctatggtacgggccta
tcttccaggcgttcttctattcgaagtttttccagagcatcatctctctcaaatgcaaag
tcttatggatctttcagtaagaggggtcgctctggttcaagggcaccacaaaggctggga
gaaaattctgacactgggttcgtttatcattccgctacacattcatcatccagtttatcg
agatatacgaccagagaaagaattcctattgaactagaaagtcaaacagatgaaatacta
gaagacgagtcttctacacattctttagaatcttcagatagtaggcgatctgcaagcgaa
aataatagaggaagcttttctggtcatgatgatgttcataatcagcatagcgaatatcta
aaacctgactatcatgaaaagttttatccacagtatgcaccaaacttgcattaccaaagg
ttttacattgcggaagaggatttagttattggtatcgctgcttaccagacctcaaaattc
tggtatattatttacaacctgtgctgcttcttgactttcggattagtttatcttttaacg
agatggcttccccatctcaaagttaaattatatggcgtgaaagtgccattggctaaagca
gaatgggtcgtgatagaaaatgagtttggtgagtttgtcatacaacctatcgatcgacag
tggtataatagaccattaagtactgttttaccttttgaaaattaccctaatccgtcatat
gaaccaaatgatatcaatttgagccaccaccatgccaatgaaattaatccaaatgtgcct
atcttgatcacatttgaatacagatatattaagttcatatattcaccgctcgatgatctc
tttaaaactaacaataactggatagatcctgactgggtggatttaagtaccgtatcaaat
ggtttaactaagggggttcaagaagatagagaacttgcgtttggtaaaaatcaaattaat
ttgagaatgaaaactacttcagaaattttattcaatgaagtgttgcatccgttttatgtc
tttcaagtattttcgataattttgtggggcattgatgaatactactactacgccgcatgc
atttttttgatttctgtactgtctatttttgattcattgaatgaacagaagaaagtatcg
agaaacttagctgaaatgtcgcactttcattgtgacgttcgtgttttgagggataagttt
tggacaacgataagctcatcagaactagttccgggcgatatatatgaagtatctgaccca
aatataacaatattgccttgtgactctattcttctgtccagtgattgtatagtcaatgaa
tccatgctaactggtgaatctgtgcccgtttcgaaatttccagctacggaagaaacaatg
taccaattatgtgacgacttccagagcacccaaatatcgagttttgtttccaaatccttc
ttgtataatggtacaaatataattagagcaagaattgcccccgggcaaaccgccgctttg
gcgatggttgtaaggacaggattctcaacaacaaagggctccttggttcgttccatggtt
ttcccaaaaccaactggttttaaattctatagagattcctttaaatatattggattcatg
tcattaatcgcaattttcggtttttgcgtcagttgcgttcagttcattaaacttggttta
gacaaaaagacaatgatattaagagctttagatatcataacaattgtagtgccaccagct
ctgcccgcgactttaaccattggtaccaattttgctttgagtaggttaaaggagaaggga
atattttgtatctctccaacaaggcttaacattagtggtaaaatcgatgttatgtgtttt
gataaaactggaacacttaccgaagatggcttagatgtacttggagtacaaatatcggag
ccaaatggggttagaggccagaagtttggagaactattgagtgatattcgccaagtattt
cctaaattttctttgaacgattgtagttcgccattagattttaagtccaggaactttttc
atgtcattattaacatgtcactcgctgagatcagttgatggaaatttactcggtgaccca
ctagactttaaaatgtttcaatttaccggttggtcattcgaggaggacttccaaaaacga
gcattccattcattatacgagggaagacatgaagatgatgttttcccagaaaattcagaa
atcattcctgcggtagttcaccctgatagtaataatagagaaaatacgtttactgataat
gatcctcataattttctaggggtggtgagaagctttgaatttttatctgagctgagacgt
atgagcgtaattgttaaaacgaataatgacgacgtatattggtcgtttactaaaggtgcg
cccgaagttatttcagaaatatgtaataaatcaactttacctgcagattttgaagaagta
ctacgttgttacactcataacggatatagggttattgcatgtgctgggaagacacttcca
aaaagaacttggttatattcccaaaaagtatctagggaagaggttgagtcaaatttggaa
tttttaggtttcattatcttccaaaataaactaaaaaaagagacctctgaaactctgaaa
agtttacaagatgcaaacatcaggacgataatgtgtacgggtgataacatacttactgct
atttccgtaggtagggaagctggtttgatacaatgctctcgcgtttatgttccatccatt
aatgatacacccttgcacggtgagcccgtaatagtatggagggacgtcaatgagccagat
aaaattttggataccaagactttgaaacctgtcaagctggggaataatagtgttgaaagt
ctacgtgagtgtaactatactcttgcagttagcggcgatgtatttagactgttgttcaga
gatgaaaacgagataccagaggaatacttaaacgagattttattgaattcatcaatctac
gcaagaatgtcgcctgatgaaaagcatgaattgatgatacagctgcagaagctagattat
acagttgggttctgtggtgatggtgcaaatgattgtggggcactcaaagcggcagacgta
ggtatttccctttcggaggctgaagcttcagttgctgctccgttcacttcaaagatattt
aatattagctgcgtacttgatgtcattagggaagggcgtgctgcgttagttacatctttt
gcatgtttccagtacatgagtttgtactctgccatccaattcatcactattactatactt
tacagccgtggttctaatttgggagatttccaattcctgtacattgatttattgctgatc
gttccgatcgcaatttgcatgtcatggtccaaatcctatgaaaagatagataaaaagagg
ccttccgctaacctagtttcacctaagattttggttcctcttttgattagcgtattcttg
gtgtttttattccagttcattccatggataatcgtacaaaagatgagctggtacatcaag
ccaatcgttgggggcgacgacgccgtgcaatcttcagataataccgtattgttcttcgtc
tcaaattttcaatatattttgactgctatagttttgtctgtgggtccaccatatagagag
ccgatgtcaaaaaactttgaatttatcgttgatatcactgtctctatcggtgcaagtcta
ctgctaatgactttggatacagaatcataccttggtaagatgttacagctgacccctata
tcaaacagttttacaatgtttatcattgtatgggtgatattaaattactatgctcaactg
tatataccgccatcgataaaaggttggttaaagaaaaagaagagtagcaaaaagtataaa
ctactgatacaagaagaaatgaaattaaaagaagtttaa

DBGET integrated database retrieval system