KEGG   Saccharomyces cerevisiae (budding yeast): YOR293WHelp
Entry
YOR293W           CDS       T00005                                 

Gene name
RPS10A
Definition
(RefSeq) ribosomal 40S subunit protein S10A
  KO
K02947  small subunit ribosomal protein S10e
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03010  Ribosome
Module
sce_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    YOR293W (RPS10A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sce03011]
    YOR293W (RPS10A)
Ribosome [BR:sce03011]
 Ribosomal Proteins
  Eukaryotes
   Small subunit
    YOR293W (RPS10A)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S10_plectin DUF4364 tRNA-synt_1c_C PadR MsyB HTH_45
Motif
Other DBs
NCBI-GeneID: 854468
NCBI-ProteinID: NP_014936
SGD: S000005819
UniProt: Q08745
Position
XV:join(867098..867149,867587..867852)
Genome map
AA seq 105 aa AA seqDB search
MLMPKEDRNKIHQYLFQEGVVVAKKDFNQAKHEEIDTKNLYVIKALQSLTSKGYVKTQFS
WQYYYYTLTEEGVEYLREYLNLPEHIVPGTYIQERNPTQRPQRRY
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgttgatgccaaaggaagacagaaacaagatccaccaatacttattccaagaaggtgtt
gttgtcgccaagaaggatttcaaccaagccaagcacgaagaaattgacaccaagaacttg
tatgtcattaaggctttacaatccttgacttctaagggttacgtcaagactcaattctca
tggcaatactactactacaccttgactgaagaaggtgttgaatacttgagagaatacttg
aacttgccagaacacattgttccaggtacctacattcaagaaagaaacccaactcaaaga
ccacaaagaagatattaa

DBGET integrated database retrieval system