KEGG   Saccharomyces cerevisiae (budding yeast): YOR303W
Entry
YOR303W           CDS       T00005                                 
Symbol
CPA1
Name
(RefSeq) carbamoyl-phosphate synthase (glutamine-hydrolyzing) CPA1
  KO
K01956  carbamoyl-phosphate synthase small subunit [EC:6.3.5.5]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00220  Arginine biosynthesis
sce00240  Pyrimidine metabolism
sce00250  Alanine, aspartate and glutamate metabolism
sce01100  Metabolic pathways
sce01240  Biosynthesis of cofactors
Module
sce_M00051  De novo pyrimidine biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    YOR303W (CPA1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    YOR303W (CPA1)
   00220 Arginine biosynthesis
    YOR303W (CPA1)
Enzymes [BR:sce01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     YOR303W (CPA1)
SSDB
Motif
Pfam: GATase CPSase_sm_chain Peptidase_C26 DJ-1_PfpI
Other DBs
NCBI-GeneID: 854479
NCBI-ProteinID: NP_014947
SGD: S000005829
UniProt: P07258
Position
XV:882899..884134
AA seq 411 aa
MSSAATKATFCIQNGPSFEGISFGANKSVAGETVFTTSLVGYPESMTDPSYRGQILVFTQ
PLIGNYGVPSGEARDEYNLLKYFESPHIHVVGIVVAEYAYQYSHWTAVESLAQWCQREGV
AAITGVDTRELVQYLREQGSSLGRITLADHDPVPYVNPMKTNLVAQVTTKKPFHVSALPG
KAKANVALIDCGVKENIIRCLVKRGANVTVFPYDYRIQDVASEFDGIFLSNGPGNPELCQ
ATISNVRELLNNPVYDCIPIFGICLGHQLLALASGASTHKLKYGNRAHNIPAMDLTTGQC
HITSQNHGYAVDPETLPKDQWKPYFVNLNDKSNEGMIHLQRPIFSTQFHPEAKGGPLDTA
ILFDKFFDNIEKYQLQSQAKSSISLKVTYSTDKSRLQSINVTKLAKERVLF
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgtcctccgctgcaacaaaagctactttctgtatccaaaatggtccttcctttgaaggt
atatcttttggtgcaaacaaatctgttgctggtgaaacagttttcactacttctctggtt
ggttacccagagtccatgactgatccttcctaccgtggtcagatattagtcttcacgcaa
cccttgattggtaactacggtgtcccatccggcgaagcccgcgatgaatacaatttactg
aagtattttgaatctccgcatatacatgtggtcggcatcgttgtcgctgaatatgcttat
caatattcgcattggaccgctgttgaatctctggcacaatggtgtcagagagaaggtgtt
gctgctattactggcgtagacacccgtgaactagtgcaatacttgagggaacaaggttct
tctttgggccgtattacgttggctgatcatgaccctgtcccctacgtgaatcccatgaaa
actaacttggttgctcaagtcaccacaaaaaagcctttccacgtctctgccttacctggg
aaggctaaggcaaatgtggctcttattgactgtggtgttaaagaaaacattatcagatgc
ctagtcaaaagaggtgccaatgtaactgttttcccctatgattacagaattcaagatgtt
gcttctgaattcgacggtattttcttatccaatggaccaggcaacccagaactatgccaa
gctacaatttccaacgtcagggaattactaaataaccctgtttatgactgtatccctatt
tttgggatttgtctaggccatcaactcttggctctggcctccggtgcctctactcacaaa
ttgaaatatggtaatagggctcacaacatccctgccatggatttgactaccggccagtgc
cacattacatctcaaaatcatggctatgcagttgatcctgagaccctaccaaaggaccaa
tggaaaccttattttgttaatttaaacgacaaatcaaacgaaggcatgatacaccttcaa
agacccatattttctacccaatttcacccagaggcaaaaggtggtcccttagacacagct
attctttttgacaaattcttcgataatatagaaaaataccaattacaatctcaggcaaaa
agttcaatctcactaaaagtaacatacagtaccgataaatcgagattgcagagtataaat
gttactaagttggccaaggaaagagtgttgttctaa

DBGET integrated database retrieval system