KEGG   Saccharomyces cerevisiae (budding yeast): YOR310C
Entry
YOR310C           CDS       T00005                                 
Symbol
NOP58, NOP5
Name
(RefSeq) RNA-processing protein NOP58
  KO
K14565  nucleolar protein 58
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    YOR310C (NOP58)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sce03009]
    YOR310C (NOP58)
Ribosome biogenesis [BR:sce03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    YOR310C (NOP58)
SSDB
Motif
Pfam: Nop NOP5NT DUF4604
Other DBs
NCBI-GeneID: 854487
NCBI-ProteinID: NP_014955
SGD: S000005837
UniProt: Q12499
Structure
Position
XV:complement(896825..898360)
AA seq 511 aa
MAYVLTETSAGYALLKASDKKIYKSSSLIQDLDSSDKVLKEFKIAAFSKFNSAANALEEA
NSIIEGKVSSQLEKLLEEIKKDKKSTLIVSETKLANAINKLGLNFNVVSDAVTLDIYRAI
KEYLPELLPGMSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLDDLDKELNTY
AMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRSKASETDLSEILPEEIEERVKTAAE
VSMGTEITQTDLDNINALAEQIVEFAAYREQLSNYLSARMKAIAPNLTQLVGELVGARLI
AHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHASLVGQATGKNKGKIA
RVLAAKAAVSLRYDALAEDRDDSGDIGLESRAKVENRLSQLEGRDLRTTPKVVREAKKVE
MTEARAYNADADTAKAASDSESDSDDEEEEKKEKKEKKRKRDDDEDSKDSKKAKKEKKDK
KEKKEKKEKKEKKEKKEKKEKKSKKEKKEKK
NT seq 1536 nt   +upstreamnt  +downstreamnt
atggcttacgttttaactgaaacttcagctggttatgctcttttaaaagcttccgataag
aaaatctacaaatcttcaagcttaattcaagacttggatagctctgacaaagtcttgaag
gaattcaagatcgccgccttttccaagttcaactctgcagctaacgctttagaggaagcc
aactccattattgaaggtaaagtttcttcccaattagaaaaacttctggaagaaattaaa
aaggacaagaagtcgaccttgattgttagtgaaactaaactggcaaacgctattaataag
ttgggattgaacttcaatgttgtttccgatgctgtaaccttagatatctatagagctatc
aaagaatatttgccagaattgctgccaggtatgtctgataatgatctaagcaagatgtct
ttgggtttagctcattccatcggtcgtcacaaattaaaattttctgctgacaaagttgat
gttatgattattcaagcaattgctttattggatgatttagataaagaattaaacacatat
gccatgagatgtaaagaatggtacgggtggcactttcctgagttagctaagattgttact
gattccgtcgcttatgcgagaattattctaacaatgggtatcagatccaaggcttctgaa
acagatttgagtgaaatcttaccagaagagattgaagaacgtgtcaaaaccgctgctgaa
gtgtctatgggtactgaaatcactcaaaccgatctagacaacattaatgctttagctgaa
caaatagtcgaatttgccgcttacagagaacagttgtccaattacttgtctgcaagaatg
aaggctattgctccaaacttgactcagttggttggtgaattagttggtgctagacttatc
gctcattcaggttccttaatttccttggccaaatcaccagcttctaccatccaaatatta
ggtgccgaaaaggctttattcagagctttaaagaccaagcatgatacaccaaagtatggt
ttgctatatcatgcctctcttgttggtcaagctactggtaagaacaaaggtaagattgca
agagttctggctgctaaggccgctgtctcattgcgttatgatgctttagctgaagataga
gacgattcaggtgacattggtctagaatcaagagccaaagtagaaaatagattatcccaa
ttagaaggtagagatttaagaactactccaaaggttgttcgtgaggctaagaaggtggaa
atgactgaagctagggcctacaatgcagatgctgataccgcaaaggctgcttctgattct
gaatccgattctgatgatgaagaggaagaaaagaaagaaaagaaagaaaagaagagaaag
agagacgatgatgaagattccaaggattctaaaaaagctaagaaggaaaagaaggacaag
aaggaaaagaaggaaaagaaggaaaagaaggagaagaaagagaagaaagagaagaaggaa
aagaagtccaagaaagagaagaaagagaagaaataa

DBGET integrated database retrieval system