KEGG   Saccharomyces cerevisiae (budding yeast): YOR320CHelp
Entry
YOR320C           CDS       T00005                                 

Gene name
GNT1
Definition
(RefSeq) glucose N-acetyltransferase
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_transf_8 Mannosyl_trans3
Motif
Other DBs
NCBI-GeneID: 854498
NCBI-ProteinID: NP_014965
SGD: S000005847
UniProt: Q12096
Position
XV:complement(913619..915094)
Genome map
AA seq 491 aa AA seqDB search
MRLISKRRIRFIVFILFGVLTVFVVSRLVVHFQYNQEIKFYKKYFQQRKDGLHEIYNPLE
IKQIPKETIDDLYTARLDKELKNGEVIEWSKFAYVNYVTNADYLCNTLIIFNDLKQEFET
KAKLVLLISKDLLDPNTSSNVAYISSLLNKIQAIDEDQVVIKLIDNIVKPKDTTPWNESL
TKLLVFNQTEFDRVIYLDNDAILRSSLDELFFLPNYIKFAAPLTYWFLSNSDLEKSYHET
RHREKQPINLQSYTKVLTKRIGKGQMIYNHLPSLPHSLYLNSNNIAQDIISSTSSLSPLF
DFQSSKKVGKLKFASNLMVINPSKEAFDEIVNVMLPKILNKKEKYDMDLINEEMYNLKKI
IYKQFIFFRKVRKLFKPEVLVLPFARYGLLTGSLRNPRHYSIIYNDVLGYKTLDNDGNDI
PVGLNDSVAYSKYIHFSDYPLAKPWNYPSMKEFECIVKEEDAEDSKLEHQACDLWNSVYA
SYIQSREICLV
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaggttgatatccaaaagaagaatcagatttattgtgtttattttgttcggcgtcctc
actgtattcgtagtatcaagacttgttgttcattttcagtataaccaagaaataaagttc
tataaaaagtattttcaacagaggaaggatgggcttcacgaaatttacaacccattagaa
atcaagcaaatacccaaggaaacgatagatgacttatataccgcccgtttagataaagag
ttgaaaaacggtgaggtcatcgagtggtccaagtttgcatacgtgaattatgtgactaat
gctgattatctttgtaatacgctgatcatattcaatgatctgaaacaggagtttgagaca
aaggccaagttagttcttctgatatctaaagatctgctagacccaaacacttcctcaaat
gtggcttacattagttcactccttaacaagattcaagctatagatgaggaccaggtagtt
atcaagttgatagataacattgtgaagccaaaggatactacaccttggaatgaaagttta
acaaaattactagtatttaaccaaacagaatttgaccgtgtgatttatcttgacaacgac
gcaattttaagatcaagcttggacgaattatttttcctaccaaattatatcaaatttgca
gctccattaacatactggtttttatctaacagtgatttggaaaaatcataccatgaaacg
cgacaccgtgaaaagcaaccaatcaacctccagtcgtatacaaaagtgctgactaaaaga
attgggaaaggtcagatgatttataatcatttgccgagtttgccgcattcattgtacttg
aattctaataacatagctcaggacattataagttctacatcatctttatcgccgttattt
gatttccaaagtagtaaaaaggttggaaaattaaaatttgcttctaatttaatggttatt
aatccttcaaaggaggcgtttgatgaaattgtgaacgttatgctgcccaagattttaaac
aagaaggaaaagtacgatatggatttgatcaatgaagaaatgtacaatttaaagaagatt
atttataaacagtttattttcttcagaaaagtccgaaaacttttcaaaccagaagtattg
gttttgccatttgcaaggtacggcttactgacgggttcattgagaaacccacggcactat
tctataatctataatgacgttttgggttataagacattggataatgatggcaacgatatt
ccggtaggattaaacgacagtgtcgcatattctaagtacatacatttttcggattatcca
ttggccaagccctggaattatccatcaatgaaggagtttgaatgtatcgttaaagaagaa
gacgcggaggattcaaagctagagcaccaagcttgtgacctttggaactcggtgtacgct
tcttacatacagtccagggaaatctgcctcgtttga

DBGET integrated database retrieval system