KEGG   Saccharomyces cerevisiae (budding yeast): YOR323CHelp
Entry
YOR323C           CDS       T00005                                 

Gene name
PRO2
Definition
(RefSeq) glutamate-5-semialdehyde dehydrogenase
  KO
K00147  glutamate-5-semialdehyde dehydrogenase [EC:1.2.1.41]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00330  Arginine and proline metabolism
sce00332  Carbapenem biosynthesis
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01130  Biosynthesis of antibiotics
sce01230  Biosynthesis of amino acids
Module
sce_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    YOR323C (PRO2)
  09110 Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    YOR323C (PRO2)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.41  glutamate-5-semialdehyde dehydrogenase
     YOR323C (PRO2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh URO-D Phi_1
Motif
Other DBs
NCBI-GeneID: 854501
NCBI-ProteinID: NP_014968
SGD: S000005850
UniProt: P54885
Structure
PDB: 

Position
XV:complement(921535..922905)
Genome map
AA seq 456 aa AA seqDB search
MSSSQQIAKNARKAGNILKTISNEGRSDILYKIHDALKANAHAIEEANKIDLAVAKETGL
ADSLLKRLDLFKGDKFEVMLQGIKDVAELEDPVGKVKMARELDDGLTLYQVTAPVGVLLV
IFESRPEVIANITALSIKSGNAAILKGGKESVNTFREMAKIVNDTIAQFQSETGVPVGSV
QLIETRQDVSDLLDQDEYIDLVVPRGSNALVRKIKDTTKIPVLGHADGICSIYLDEDADL
IKAKRISLDAKTNYPAGCNAMETLLINPKFSKWWEVLENLTLEGGVTIHATKDLKTAYFD
KLNELGKLTEAIQCKTVDADEEQDFDKEFLSLDLAAKFVTSTESAIQHINTHSSRHTDAI
VTENKANAEKFMKGVDSSGVYWNASTRFADGFRYGFGAEVGISTSKIHARGPVGLDGLVS
YQYQIRGDGQVASDYLGAGGNKAFVHKDLDIKTVTL
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgtccagttcacaacaaatagccaaaaatgcccgtaaagcagggaatattttgaaaacc
atctcaaacgagggcagatcagatattttatacaaaattcacgatgccctgaaggctaat
gcgcatgccattgaagaagcgaataaaatcgatttagctgttgccaaagagactggccta
gcggattctttattgaaacgtctcgacctatttaaaggggacaaatttgaagttatgtta
caaggtattaaggatgtagccgaactagaagaccctgttggcaaggttaaaatggccagg
gaattagatgatggcttgacgttgtaccaagtaaccgctccagtcggcgttttgttagtt
atctttgaatcccgtccagaagttattgccaatattaccgcattgagtatcaagtctggt
aatgctgcaattttgaagggtggtaaagagtctgtgaacacgttcagagaaatggcaaag
atcgttaacgacaccattgcacaattccaaagtgagactggtgttcctgtgggctctgtg
caattgatcgaaaccagacaggatgtttccgacttgttggatcaagatgagtacatcgac
ttagttgttcctcgtggttccaatgccttagtcagaaaaatcaaggacactacaaaaatt
cccgtgttgggtcatgcggatggtatctgctcaatttacttggatgaagacgcagatttg
attaaggcaaaaagaattagtttggatgcaaagactaactacccagctggttgcaacgct
atggaaacgttgttgattaacccaaaattctctaagtggtgggaagttctggaaaactta
actttggaaggcggagtgactatccacgctacaaaagatttgaaaactgcgtattttgat
aaactgaatgagttagggaaattgacagaagcaattcaatgcaaaaccgttgatgctgat
gaggagcaagattttgataaggaatttttatccttggatttggctgccaagtttgttaca
tctacagaatcggccattcaacatataaatacacactcttcgagacataccgacgctatt
gtaacggaaaataaagcaaacgctgaaaaatttatgaagggtgtcgactcctctggtgtt
tactggaatgcatcaactagatttgccgatggtttcaggtacggttttggtgctgaagtg
ggtatttctacctctaagattcacgcccgtggtccagttggcttggacggtctggtgagt
tatcaataccaaataagaggtgacggccaggttgctagtgactaccttggtgctggtggt
aacaaagcttttgttcacaaggatttagatataaagactgtgacattataa

DBGET integrated database retrieval system