KEGG   Saccharomyces cerevisiae (budding yeast): YOR327CHelp
Entry
YOR327C           CDS       T00005                                 

Gene name
SNC2
Definition
(RefSeq) SNAP receptor SNC2
  KO
K08513  vesicle-associated membrane protein 4
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    YOR327C (SNC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YOR327C (SNC2)
Membrane trafficking [BR:sce04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   VAMP
    YOR327C (SNC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Synaptobrevin Prominin DUF3671 DUF2116
Motif
Other DBs
NCBI-GeneID: 854505
NCBI-ProteinID: NP_014972
SGD: S000005854
UniProt: P33328
Position
XV:complement(930734..931081)
Genome map
AA seq 115 aa AA seqDB search
MSSSVPYDPYVPPEESNSGANPNSQNKTAALRQEIDDTVGIMRDNINKVAERGERLTSIE
DKADNLAISAQGFKRGANRVRKQMWWKDLKMRMCLFLVVIILLVVIIVPIVVHFS
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcatcagtgccatacgatccatatgtgcctccagaggagagtaactcaggcgca
aacccaaattcccaaaacaagactgctgctttgagacaagagattgatgacacggtggga
ataatgagagataatatcaacaaggttgctgaacgtggtgaaaggctaacatccattgag
gacaaagctgataacttggctatctccgcacaaggattcaagagaggcgccaacagggtc
agaaagcaaatgtggtggaaagatctaaaaatgagaatgtgtttattcttagttgttatt
attttactagtggtaattatcgttcctatcgtcgtccatttcagctaa

DBGET integrated database retrieval system