KEGG   Saccharomyces cerevisiae (budding yeast): YOR328W
Entry
YOR328W           CDS       T00005                                 

Symbol
PDR10
Name
(RefSeq) ATP-binding cassette multidrug transporter PDR10
  KO
K08711  ATP-binding cassette, subfamily G (WHITE), member 2, PDR
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sce00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    YOR328W (PDR10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YOR328W (PDR10)
Transporters [BR:sce02000]
 ABC transporters, eukaryotic type
  ABCG (White) subfamily
   ABCG2, 3 subgroups
    YOR328W (PDR10)
SSDB
Motif
Pfam: ABC2_membrane ABC_tran PDR_CDR ABC_trans_N ABC2_membrane_7 AAA_25 AAA_21 AAA_16 AAA_33 RsgA_GTPase AAA_29 AAA_23 AAA_18 AAA_22 SMC_N AAA_28 DnaB_C
Other DBs
NCBI-GeneID: 854506
NCBI-ProteinID: NP_014973
SGD: S000005855
UniProt: P51533
Position
XV:931803..936497
AA seq 1564 aa
MLQAPSSSNSGLNQGNAAPDGPPNETQPYEGLDAAAQEEIKELARTLTSQSSLLSQEKRI
TGTGDPNTLTAASSSSLSRSIFASDIKGVNPILLDVNDPDYDETLDPRSENFSSVRWVRN
MAQICENDSDFYKPFSLGCAWKDLSASGDSADITYQGTFGNMPIKYLKMSWRCISRRLFH
RTHGKSEDNDSGFQILKPMDGCINPGELLVVLGRPGAGCTTLLKSISVNTHGFKISPDTI
ITYNGFSNKEIKNHYRGEVVYNAESDIHIPHLTVFQTLYTVARLKTPRNRIKGVDRDTFA
KHMTEVAMATYGLSHTADTKVGNDFVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLD
SATALEFIKALKTQATITKSAATVAIYQCSKDAYDLFDKVCVLYDGYQIFFGPSKQAKKY
FQRMGYVCPERQTTADYLTSITSPSERIKDKDMVKHGIMIPQTAYEMNQYWIQSEEYKQL
QVQVNKHLDTDSSQQREQIKNAHIAKQSKRARPSSPYTVSFFLQVKYILIRDIWRIKNDP
SIQLFTVLSHAAMALILGSMFYEVMLSTTTTTFYYRGAAIFFAILFNAFSSLLEIFSLYE
TRPITEKHKTYSLYRPSADAFASTFSDVPTKLATAVTFNIPYYFLINLKRDAGAFFFYFL
INIITVFAMSHLFRCIGSVSKTLPQAMVPASVLLLAFAMYTGFAIPRVQMLGWSKWISYI
NPLSYLFESLMINEFHGRNFPCAQYIPSGPNYVNATGDEVTCSALGSIPGNNYVSGDDFI
QTNYGYRHKNKWRSVGIGLAYIIFFLFLYLFFCEYNEGAKQNGEMLVFPHSVVKKMKKKG
IVSEKKKKNQPTLSTSDAEKDVEMNNNSSATDSRFLRDSDAAIMGNDKTVAKEHYSSPSS
SASQSNSFSKSDDIELSKSQAIFHWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGA
SGAGKTTLLDCLAERTTMGLITGDVFVDGRPRDQSFPRSIGYCQQQDLHLKTATVRESLR
FSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAA
KPKLLVFLDEPTSGLDSQTAWSTCQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQE
GGQTVYFGELGKGCKTMINYFEAHGAHKCPPDANPAEWMLEIVGAAPGTHASQDYFAIWR
DSEEYREMQKELDWMERELPKRTEGSSNEEQKEFATSTLYQIKLVSYRLFHQYWRTPFYL
WSKFFSTIVSELFIGFTFFKANTSLQGLQNQMLAIFMFTVVFNPILQQYLPLFVQQRELY
EARERPSRTFSWKAFIVSQILVEIPWNLLAGTIAFFVYYYPVGFYRNASYANQLHERGAL
FWLFACAFYVYISSMGVLVISCIEIAENAANLASLFFIMSLSFCGVLATPNILPRFWIFM
YRVSPLTYLIDALLSVGLANASVVCSSNELLKIVPPSGMTCSEYMEPYMQSTGTGYLLDG
SSETECHFCQFSSTNDYLATVSSSYSRRWMNYGIFSAYIVFDYCAAIFLYWLVRVPKKSK
KLKK
NT seq 4695 nt   +upstreamnt  +downstreamnt
atgttgcaagcgccctcaagttcaaactcgggtttgaatcaaggaaatgctgcgccggac
ggcccacctaacgaaacacagccgtacgaaggcctcgacgcggcagctcaagaagaaata
aaagaattggcaagaacgctgacgagccaatcttcccttttatcgcaagaaaagcgtatt
accggcactggcgacccgaatacactaactgctgcttcttcatcgtcattgagccggtca
attttcgctagtgatatcaagggagttaacccaatccttttggacgtcaatgatccagac
tacgatgagacattggatcctcgatcagaaaatttctcgagtgtcagatgggtacgaaat
atggcacaaatatgcgagaatgattcggatttctataaaccgttttcattaggttgcgcc
tggaaagatttgagtgcctccggtgattctgccgatataacatatcagggaacatttggt
aatatgcccatcaaatacttgaaaatgagttggaggtgcatatcccgacgtcttttccac
cggacacatggcaagagtgaagataatgactccggtttccaaattttgaagccgatggac
ggatgcatcaatccgggggaactacttgttgtgcttggacgacccggtgcaggatgtact
acgctgctgaaatctatatctgtaaatacacacggattcaagatttctccggacacaatc
atcacgtacaatggattctccaacaaagagatcaaaaaccattaccgtggtgaagtggtc
tacaatgcagaatcagacattcacatcccgcacttgacagtattccaaactttatacaca
gtggcaagactgaagacaccaaggaaccgaatcaagggtgtcgatagggacacatttgcc
aaacacatgactgaagtggcaatggcaacttacggactgagccacactgcagatacaaaa
gtgggtaatgattttgttcgtggtgtatccgggggagaaaggaaaagagtttccattgct
gaagtgtctatatgtggctcgaagtttcagtgctgggataatgccacgaggggcttagat
tctgctaccgcgctggagttcatcaaggccttgaaaacgcaagccactatcacaaagtct
gcagccactgtggccatttaccaatgttctaaagatgcctatgatttgttcgataaagtc
tgtgttctttacgatggttaccaaatcttctttggcccaagtaagcaggccaaaaagtac
tttcaaagaatgggatatgtgtgtcccgaaaggcagaccacagcagattatttgacctct
attactagtccttctgaaagaattaaggacaaagacatggtcaaacatggaattatgatc
ccacaaacggcctatgaaatgaaccagtactggattcaatcagaggaatacaaacaatta
caggtgcaggtgaacaaacatttagatacagactcttcccagcaaagagaacaaataaaa
aatgcacatattgccaaacaatctaagagagcacggccctcctctccttatacagtaagt
ttctttttgcaagttaagtatattctaatcagggatatatggaggattaagaatgaccca
agtattcaacttttcacggttttgagtcatgcagcaatggctcttatcttgggatcaatg
ttttatgaagtcatgctttccactaccacaacaaccttttattaccgaggcgcggctatt
ttttttgctattctgttcaatgcgttctcatcacttttagagatcttttcactctatgag
acgaggcccattaccgaaaagcacaagacttactcgttatatcgcccaagtgctgatgcc
ttcgcctctacattttctgatgttccaacaaaattagccacggcagtaactttcaacata
ccatattattttttaatcaatctaaaaagagatgccggtgcttttttcttttacttttta
ataaacattataacagtttttgctatgtcgcatttgttcagatgcattggctcagtgtcg
aaaactttacctcaggcaatggttcccgcatctgttcttctgttagcttttgcaatgtac
actgggtttgccatcccaagagtccaaatgcttggctggtcaaaatggatttcttatatc
aacccattgtcttacctttttgaatcgctaatgattaacgaatttcatggtagaaatttc
ccatgtgctcagtatatacctagtgggccaaattatgtcaacgcaacaggtgacgaagtc
acctgctccgccctcggttctatcccaggaaataattatgtaagtggtgatgatttcatt
caaacgaactacggctatcgacataagaacaaatggcggtctgttggtattggtttagca
tacattatttttttcttatttctgtatttattcttttgtgaatacaatgaaggagcaaag
caaaatggtgagatgttagtatttccccatagtgtggttaaaaagatgaagaagaagggt
attgtctctgagaagaaaaagaaaaaccaaccaacgttgtcaacatctgatgctgagaaa
gatgtagagatgaacaacaattcaagtgcgactgattcaagatttttacgcgattctgat
gcagctataatgggtaacgataaaactgtcgccaaggagcattattcatctccttcatct
tctgcgtctcaaagcaatagttttagtaaaagtgatgacattgaattgtccaaatcacaa
gcgatttttcattggaaaaacttatgctacgatatcccgattaagaatgggaagaggaga
attttggataatgttgatggttgggtcaagcctggtacactaactgccttgattggcgca
tctggtgcaggaaaaacaacgttattagattgtcttgccgagagaaccacgatgggttta
atcactggtgatgtattcgtagatggtagaccgcgggaccagtctttccccagatcaatt
ggttattgtcagcagcaggatttgcatttgaaaaccgcaactgtgagagagtcattaagg
ttttccgcgtacctgcgtcaagccgatgatgtatccatcgaggagaaagataaatacgtt
gaagaagtcattgaggtattggagatgaaactttatgctgatgccatagtaggcgttcct
ggtgaaggtttaaatgtggaacaaagaaaaaggttaaccataggtgtggagttagctgcc
aaaccaaaactgttggtatttttagatgagcccacgtctgggcttgattcccaaactgca
tggtcaacttgtcaattaatgaagaaattggctagtcgcggacaagcaattttatgtacc
attcatcaaccttctgctctcttaatgcaagagtttgataggttactatttttgcaagag
ggcggacaaactgtatattttggagagctagggaaaggttgcaaaacaatgattaactat
ttcgaagctcatggtgcccataaatgcccaccagatgccaatccagccgaatggatgtta
gaaatagtaggtgctgcaccaggaactcacgctagtcaagattattttgccatttggaga
gattctgaagaatatagggaaatgcagaaagagttggactggatggaacgagaattgcct
aaacggacggaaggttcgtcaaatgaggagcagaaggagttcgctacgtcaactttgtac
cagatcaaattggtgagttatcgattattccatcaatattggagaacaccattttactta
tggtcaaaatttttttcaacaattgtgtctgaactcttcataggcttcacttttttcaag
gcgaatacatcattacagggcctacagaatcaaatgctggccatttttatgtttacagtg
gtattcaacccaatattgcaacaatatttaccacttttcgttcagcagagggaactttat
gaagctagagaaaggccatcaagaaccttttcgtggaaagcatttattgtatcgcagatt
ctcgtggaaatcccttggaatttactggccggtactatagcttttttcgtctattattat
cctgttggattttacagaaatgcttcttatgcaaatcaacttcatgaacgaggagcttta
ttttggttatttgcgtgcgcgttttacgtctacatcagttcaatgggggtattagtgatt
tcatgcattgaaattgcagaaaatgctgcgaatctcgcttcacttttctttataatgtca
ttatctttctgcggtgttctggctacgccaaatattctaccaagattctggatttttatg
tatagagtatcgccactgacatacctcattgatgctctgctatcggtaggactggccaat
gctagtgtcgtttgttccagcaacgaacttttaaaaattgttcctccaagcggtatgaca
tgctcggaatatatggaaccttatatgcaatccaccgggacgggttatctgctcgatggg
agttccgaaactgaatgtcacttttgtcaattcagttctaccaatgattatctggcgact
gtgagttcttcgtattcacgtagatggatgaactatggcatttttagtgcatatattgtc
tttgactattgtgcagcaatatttttatactggctggtgcgggttccaaagaaaagcaaa
aaattaaagaaataa

DBGET integrated database retrieval system