KEGG   Saccharomyces cerevisiae (budding yeast): YOR330CHelp
Entry
YOR330C           CDS       T00005                                 

Gene name
MIP1
Definition
(RefSeq) DNA-directed DNA polymerase gamma MIP1
  KO
K02332  DNA polymerase gamma 1 [EC:2.7.7.7]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04139  Mitophagy - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04139 Mitophagy - yeast
    YOR330C (MIP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YOR330C (MIP1)
   03029 Mitochondrial biogenesis [BR:sce03029]
    YOR330C (MIP1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     YOR330C (MIP1)
DNA replication proteins [BR:sce03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase gamma complex (mitochondrial)
    YOR330C (MIP1)
Mitochondrial biogenesis [BR:sce03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Mitochondrial DNA polymerase
    YOR330C (MIP1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNApol_Exo DNA_pol_A
Motif
Other DBs
NCBI-GeneID: 854508
NCBI-ProteinID: NP_014975
SGD: S000005857
UniProt: P15801
Position
XV:complement(939621..943385)
Genome map
AA seq 1254 aa AA seqDB search
MTKLMVRSECMLRMVRRRPLRVQFCARWFSTKKNTAEAPRINPVGIQYLGESLQRQVFGS
CGGKDEVEQSDKLMELSKKSLKDHGLWGKKTLITDPISFPLPPLQGRSLDEHFQKIGRFN
SEPYKSFCEDKFTEMVARPAEWLRKPGWVKYVPGMAPVEVAYPDEELVVFDVETLYNVSD
YPTLATALSSTAWYLWCSPFICGGDDPAALIPLNTLNKEQVIIGHNVAYDRARVLEEYNF
RDSKAFFLDTQSLHIASFGLCSRQRPMFMKNNKKKEAEVESEVHPEISIEDYDDPWLNVS
ALNSLKDVAKFHCKIDLDKTDRDFFASTDKSTIIENFQKLVNYCATDVTATSQVFDEIFP
VFLKKCPHPVSFAGLKSLSKCILPTKLNDWNDYLNSSESLYQQSKVQIESKIVQIIKDIV
LLKDKPDFYLKDPWLSQLDWTTKPLRLTKKGVPAKCQKLPGFPEWYRQLFPSKDTVEPKI
TIKSRIIPILFKLSWENSPVIWSKESGWCFNVPHEQVETYKAKNYVLADSVSQEEEEIRT
HNLGLQCTGVLFKVPHPNGPTFNCTNLLTKSYNHFFEKGVLKSESELAHQALQINSSGSY
WMSARERIQSQFVVPSCKFPNEFQSLSAKSSLNNEKTNDLAIIIPKIVPMGTITRRAVEN
AWLTASNAKANRIGSELKTQVKAPPGYCFVGADVDSEELWIASLVGDSIFNVHGGTAIGW
MCLEGTKNEGTDLHTKTAQILGCSRNEAKIFNYGRIYGAGAKFASQLLKRFNPSLTDEET
KKIANKLYENTKGKTKRSKLFKKFWYGGSESILFNKLESIAEQETPKTPVLGCGITYSLM
KKNLRANSFLPSRINWAIQSSGVDYLHLLCCSMEYIIKKYNLEARLCISIHDEIRFLVSE
KDKYRAAMALQISNIWTRAMFCQQMGINELPQNCAFFSQVDIDSVIRKEVNMDCITPSNK
TAIPHGEALDINQLLDKSNSKLGKPNLDIDSKVSQYAYNYREPVFEEYNKSYTPEFLKYF
LAMQVQSDKRDVNRLEDEYLRECTSKEYARDGNTAEYSLLDYIKDVEKGKRTKVRIMGSN
FLDGTKNAKADQRIRLPVNMPDYPTLHKIANDSAIPEKQLLENRRKKENRIDDENKKKLT
RKKNTTPMERKYKRVYGGRKAFEAFYECANKPLDYTLETEKQFFNIPIDGVIDDVLNDKS
NYKKKPSQARTASSSPIRKTAKAVHSKKLPARKSSTTNRNLVELERDITISREY
NT seq 3765 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaattgatggttagatctgaatgcatgctgcgaatggtgcggcggcggccgctg
cgtgtgcagttttgtgctcgatggttctccacaaagaagaataccgcagaagcacccagg
attaatcctgtggggatacagtatttaggtgagtctttgcaaagacaggtatttggtagt
tgcggtggtaaagatgaggtggagcaaagcgacaaacttatggagttatcgaaaaagtcg
ctaaaggaccatgggttgtgggggaagaagacgctcatcacggatccaatatcgtttcct
ctgccgccactacaaggcaggtcgctagatgagcatttccagaagattgggcgtttcaat
tctgaaccgtacaagagtttttgcgaggacaagttcacggagatggtggcacgaccggcg
gaatggctgcggaagccaggctgggttaaatacgtacctggaatggcacccgtcgaagtg
gcatacccagacgaagagctggtggtgtttgatgtagaaacactctataacgtctctgac
tatccgactttggccacggccttgtcatcgacggcgtggtacctttggtgttcgccgttc
atatgtggtggtgatgatcctgctgcactgatacccctaaacacattgaataaagagcaa
gtaataattggtcacaatgttgcgtatgatagggcacgggttctcgaagaatacaacttc
agggactcgaaggcgtttttcctcgacactcaatctctgcatattgcatctttcgggctg
tgttcaagacaacgtccgatgttcatgaagaataacaagaaaaaagaggcagaagtggaa
tcggaagtacatccagaaatttccatagaagattatgacgacccttggttaaatgtgtct
gctttaaactcgctaaaggatgtagcgaaatttcactgcaagatagatcttgataagact
gatagagatttctttgcttccacagataaatcaacgataatagaaaatttccaaaaactg
gtcaactactgcgccactgacgtaacggccacaagccaagtgtttgatgagattttccct
gttttcctgaaaaagtgtcctcatccagtttcgtttgcaggtttaaagtccttaagcaaa
tgcattctgccgacgaagctaaacgactggaatgattacttgaacagctctgagtctttg
taccaacagtccaaagtccagatagaatccaaaattgttcaaatcataaaagatatcgtc
ctgttgaaggacaaaccagatttttatctcaaggatccctggttatcacaattggattgg
accaccaaacctttaagattgacaaagaaaggtgttcctgcaaagtgtcaaaagctgccc
ggctttccagaatggtatagacaactttttccctcaaaggacactgtagaacctaagatc
actattaaatcaagaataattccgattttgttcaagttatcgtgggagaattcccccgta
atatggtcgaaggagtctggatggtgcttcaacgtgccccatgaacaagtagaaacatac
aaggctaaaaattatgttttggcagatagcgtatctcaagaggaagaggaaataagaacg
cataacctaggattgcaatgcacaggtgttcttttcaaagtacctcatcccaatgggccg
acttttaattgcactaatcttttaaccaaatcgtataaccatttttttgaaaagggcgta
ctaaaatctgagtcagaattggctcatcaggctttacaaattaactcttcagggtcttat
tggatgtcagcaagggaaagaatccaatcccaatttgtagtccccagttgtaaattccct
aatgagttccagtctttgtccgcaaaatcgtcgttaaataatgagaagacaaatgatctt
gccataattataccgaaaatcgtccccatgggcacaatcactagaagagctgtggaaaat
gcgtggttaaccgcatccaatgcaaaagcaaataggataggttccgaattgaaaactcaa
gtcaaagctcctccaggttattgttttgttggggcggacgtggatagtgaggaattgtgg
atagcatctttagtcggtgactccattttcaatgttcatggtggtaccgccattggttgg
atgtgtttagaaggcactaaaaacgaaggtacagatttgcacacgaagactgctcaaatt
ttggggtgttctcgtaatgaggcgaaaatttttaattatggtagaatttacggcgctggt
gctaaatttgcgagtcagttacttaaaaggtttaacccatctctaactgatgaagagaca
aaaaaaattgcgaataagttatatgaaaatacgaaaggtaaaacgaaaagatcaaaatta
ttcaaaaaattttggtatggtggatctgagtcaattctattcaataaattagaaagcatc
gcggaacaagaaactccaaagacaccggtactgggatgtggtattacctattcacttatg
aagaaaaatctgagggcgaattcctttctaccttcaagaatcaattgggccatccagtca
tctggagtggattatctacatcttctttgttgctccatggaatatattattaagaaatat
aaccttgaggcaaggctttgcatttccatccatgatgagattagatttttggtgagcgaa
aaggacaaatacagagctgctatggctttgcaaatcagcaacatatggacgagagcaatg
ttttgccagcaaatggggataaatgaattaccgcaaaactgtgcctttttctcgcaagta
gatattgattctgtcatacgtaaagaagtcaatatggactgcataaccccctcgaacaaa
accgccattcctcatggggaggcgcttgatatcaatcaactgctagacaaatccaatagt
aaattgggtaaaccaaatctcgatatcgacagcaaagtatcacaatatgcctataactac
agagaacctgtatttgaagaatataataaatcttatactccagagttcttaaaatatttt
cttgcgatgcaagtccagtcagataagcgcgatgtgaatcggctagaagatgagtatctg
cgggagtgtacatccaaagaatacgctagagatgggaacactgcagagtacagcctccta
gactatataaaggatgtcgagaagggcaaaaggactaaagtacgtattatgggatccaat
tttttagatggtaccaaaaatgccaaagctgatcaacgaatcagattacctgtcaatatg
ccagattatcccacacttcataaaattgctaacgattcagcaatcccagaaaagcaattg
ctggagaacaggagaaagaaggaaaacaggatagatgacgaaaataagaaaaaattaacc
agaaaaaagaataccacgcctatggaaaggaagtacaaaagagtgtatggtggcaggaag
gcatttgaagcgttctatgaatgtgcaaataaaccgttagactatactttggagacagaa
aaacaattctttaatattcctatagatggagtgattgacgacgttctgaacgacaaatct
aattataaaaagaaaccatcacaagcaagaacggcatcatcatcgccaataagaaagact
gcgaaagcagtacattccaaaaaattgccggcaaggaagtcaagcactacaaatagaaat
ttggttgagctggaaagggacattactatttctagagagtactag

DBGET integrated database retrieval system