KEGG   Saccharomyces cerevisiae (budding yeast): YOR332WHelp
Entry
YOR332W           CDS       T00005                                 

Gene name
VMA4
Definition
(RefSeq) H(+)-transporting V1 sector ATPase subunit E
  KO
K02150  V-type H+-transporting ATPase subunit E
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00190  Oxidative phosphorylation
sce01100  Metabolic pathways
sce04145  Phagosome
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    YOR332W (VMA4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    YOR332W (VMA4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: vATP-synt_E Phlebovirus_NSM
Motif
Other DBs
NCBI-GeneID: 854509
NCBI-ProteinID: NP_014977
SGD: S000005859
UniProt: P22203
Structure
PDB: 

Position
XV:943656..944357
Genome map
AA seq 233 aa AA seqDB search
MSSAITALTPNQVNDELNKMQAFIRKEAEEKAKEIQLKADQEYEIEKTNIVRNETNNIDG
NFKSKLKKAMLSQQITKSTIANKMRLKVLSAREQSLDGIFEETKEKLSGIANNRDEYKPI
LQSLIVEALLKLLEPKAIVKALERDVDLIESMKDDIMREYGEKAQRAPLEEIVISNDYLN
KDLVSGGVVVSNASDKIEINNTLEERLKLLSEEALPAIRLELYGPSKTRKFFD
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccgctattactgctttgacaccaaaccaagtgaacgatgaattgaacaagatg
caagctttcatcagaaaggaagctgaagaaaaagcgaaggaaatccaattgaaggctgac
caagagtacgaaatcgagaagaccaacatcgtaagaaatgaaaccaacaacattgacggc
aacttcaagagcaagttgaagaaggccatgctttcgcaacagattactaagtcaacgata
gcaaacaaaatgaggttgaaggttctttctgctcgtgaacagtcgctagacgggatattc
gaggaaaccaaggaaaagttgtcaggaattgccaacaaccgggacgagtacaagcccatt
ttgcaatcattgatcgtggaggcacttttgaagttgttggaacctaaggcgattgtcaag
gctcttgaaagagacgtcgatttaatcgagtcgatgaaggacgacattatgcgtgagtat
ggggaaaaggcccagcgcgcaccattggaagagattgttatctccaatgattacttgaac
aaagaccttgtttccggcggtgttgtggtctccaatgcatcagacaagattgaaattaac
aacactttggaggaaagattgaaattgttaagtgaagaggcattgcccgccatcagattg
gaattgtatggtccttccaagacaagaaagttctttgattga

DBGET integrated database retrieval system