KEGG   Saccharomyces cerevisiae (budding yeast): YOR335CHelp
Entry
YOR335C           CDS       T00005                                 

Gene name
ALA1, CDC64
Definition
(RefSeq) alanine--tRNA ligase
  KO
K01872  alanyl-tRNA synthetase [EC:6.1.1.7]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00970  Aminoacyl-tRNA biosynthesis
Module
sce_M00359  Aminoacyl-tRNA biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    YOR335C (ALA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sce01007]
    YOR335C (ALA1)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sce03016]
    YOR335C (ALA1)
Enzymes [BR:sce01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.7  alanine---tRNA ligase
     YOR335C (ALA1)
Amino acid related enzymes [BR:sce01007]
 Aminoacyl-tRNA synthetase
  Class II (G/C)
   YOR335C (ALA1)
Transfer RNA biogenesis [BR:sce03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    YOR335C (ALA1)
 Prokaryotic Type
    YOR335C (ALA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2c tRNA_SAD DHHA1 Halogen_Hydrol Z1
Motif
Other DBs
NCBI-GeneID: 854513
NCBI-ProteinID: NP_014980
SGD: S000005862
UniProt: P40825
Position
XV:complement(946233..949109)
Genome map
AA seq 958 aa AA seqDB search
MTIGDKQKWTATNVRNTFLDYFKSKEHKFVKSSPVVPFDDPTLLFANAGMNQYKPIFLGT
VDPASDFYTLKRAYNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKEAIT
YSWTLLTEVYGIPKDRLYVTYFEGDEKLGLEPDTEARELWKNVGVPDDHILPGNAKDNFW
EMGDQGPCGPCSEIHYDRIGGRNAASLVNMDDPDVLEVWNLVFIQFNREQDGSLKPLPAK
HIDTGMGFERLVSVLQDVRSNYDTDVFTPLFERIQEITSVRPYSGNFGENDKDGIDTAYR
VLADHVRTLTFALADGGVPNNEGRGYVLRRILRRGARYARKYMNYPIGNFFSTLAPTLIS
QVQDIFPELAKDPAFLFEILDEEEASFAKTLDRGERLFEKYASAASKTESKTLDGKQVWR
LYDTYGFPVDLTELMAEEQGLKIDGPGFEKAKQESYEASKRGGKKDQSDLIKLNVHELSE
LNDAKVPKTNDEFKYGSANVEGTILKLHDGTNFVDEITEPGKKYGIILDKTCFYAEQGGQ
EYDTGKIVIDDAAEFNVENVQLYNGFVFHTGSLEEGKLSVGDKIIASFDELRRFPIKNNH
TGTHILNFALKETLGNDVDQKGSLVAPEKLRFDFSHKKAVSNEELKKVEDICNEQIKENL
QVFYKEIPLDLAKSIDGVRAVFGETYPDPVRVVSVGKPIEELLANPANEEWTKYSIEFCG
GTHVNKTGDIKYFVILEESGIAKGIRRIVAVTGTEAFEAQRLAEQFAADLDAADKLPFSP
IKEKKLKELGVKLGQLSISVITKNELKQKFNKIEKAVKDEVKSRAKKENKQTLDEVKTFF
ETNENAPYLVKFIDISPNAKAITEAINYMKSNDSVKDKSIYLLAGNDPEGRVAHGCYISN
AALAKGIDGSALAKKVSSIIGGKAGGKGNVFQGMGDKPAAIKDAVDDLESLFKEKLSI
NT seq 2877 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcggtgataagcaaaaatggaccgctactaatgtccgtaatacctttctagac
tatttcaaatctaaagaacacaagtttgtcaaatcctctccagtagttccatttgatgat
ccaactttacttttcgctaatgccggtatgaaccaatacaagcctatctttttaggtact
gtcgatccagcttccgatttctacaccttgaaaagggcttacaactctcaaaagtgtatc
agagctggtggtaaacacaacgatttagaagatgtcggtaaggattcttatcatcatacc
ttttttgaaatgctgggtaactggtcgtttggcgactatttcaagaaggaagctattact
tactcatggactttgttgactgaagtatacggcattccaaaggatagattatacgttacc
tattttgaaggtgatgaaaagttaggcttggaacctgatactgaagcccgtgaactatgg
aaaaatgttggtgttcccgatgaccatatattacctggtaatgcaaaggacaacttttgg
gaaatgggtgaccaaggcccatgtggtccttgttctgaaattcactacgatagaataggt
ggtagaaatgctgcttccttggttaatatggacgaccctgatgtcttggaagtttggaat
ttggttttcattcaattcaacagagaacaagacgggtctttgaagcctttacctgccaag
catatcgacacaggtatggggttcgaaagattggtttctgttctgcaagatgttagatct
aactatgataccgatgttttcacacctttgttcgagcgtatccaagaaatcacttcagtt
agaccatattctggcaattttggtgagaatgacaaggacggtatcgatactgcctacaga
gttttagctgatcatgtccgtacattgacttttgccttagctgacggtggcgttccaaac
aatgaaggtagaggatatgttttgagacgcattctaagaagaggtgcccgttacgcccgt
aaatacatgaattacccaatcggtaactttttctccactttggctccaactttaatttct
caggttcaagatatctttcccgaattagccaaggatcctgcattcctctttgaaatcttg
gatgaagaagaagcttctttcgctaagaccttggatcgtggtgaaagactatttgaaaaa
tatgcttctgctgcttctaagactgaatctaagactttagacggtaaacaagtttggaga
ctttacgacacttatggtttcccagtcgacttgactgaattgatggctgaagaacaaggc
ttgaagattgatggacccggtttcgaaaaggccaaacaagagtcatacgaagcatccaaa
agaggtggtaagaaggaccaaagtgatttgattaagttaaacgtccatgaattatccgag
ttgaacgatgctaaggtgcccaagactaatgatgaattcaaatacggcagcgccaacgtc
gaaggtaccattttgaaactgcatgacggtaccaactttgttgatgagatcactgaacca
ggtaagaagtacggtattattttggataaaacatgtttctacgccgaacaaggtggtcaa
gaatatgacactggtaaaattgttattgatgacgctgctgagtttaatgttgaaaatgtt
caattgtataacggttttgttttccacaccgggtctttagaagaaggtaagttgtctgtc
ggtgacaagattatcgcttcattcgatgaactacgtcgtttccctattaagaacaatcat
actggtacacatatcttaaactttgctctgaaggaaactttgggtaatgatgtcgatcaa
aagggttctttggttgccccagaaaaattgagattcgatttctctcataaaaaggctgtg
tcaaatgaagaattgaaaaaagttgaagatatctgtaatgagcaaattaaagaaaactta
caagtgttttacaaggaaattccattggacttggccaaatccattgatggtgttcgtgct
gtctttggtgagacttacccagatccagttcgtgtagtttctgttggtaagccaatcgaa
gaattgttggccaacccagctaacgaagagtggaccaagtattctattgaattttgcggt
ggtacccatgtcaacaagacaggcgatattaaatacttcgtcattttagaagagagcggt
attgcaaagggtatcagaagaattgttgctgttactggaactgaagcctttgaagctcaa
agattggctgaacagtttgctgctgatttggatgctgcagacaagctgccgttctctcca
atcaaagaaaagaagttgaaggaacttggtgtcaaacttggtcaactttcaatttctgtt
atcacaaaaaatgaactgaagcagaaatttaacaaaattgaaaaagcagtgaaggatgaa
gttaagtcaagggccaaaaaagaaaacaaacaaactcttgatgaagtgaagacatttttc
gaaaccaatgagaatgctccatacctagttaaattcattgatatttctccaaatgctaaa
gctatcactgaagcgatcaactacatgaaatccaatgattctgtcaaagacaagtcaatc
tatttattggcaggtaatgaccctgaaggtcgtgttgctcacggttgttacatctccaat
gctgctttagccaagggtattgatggttctgcgcttgccaaaaaggtgtccagtatcatc
ggcggtaaggctggtggtaaaggtaatgttttccaaggtatgggtgataaaccagccgct
ataaaggatgcagttgatgatttggaaagtttgttcaaggagaagctttccatttaa

DBGET integrated database retrieval system