KEGG   Saccharomyces cerevisiae (budding yeast): YOR340CHelp
Entry
YOR340C           CDS       T00005                                 

Gene name
RPA43
Definition
(RefSeq) DNA-directed RNA polymerase I subunit RPA43
  KO
K03004  DNA-directed RNA polymerase I subunit RPA43
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03020  RNA polymerase
Module
sce_M00182  RNA polymerase I, eukaryotes
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    YOR340C (RPA43)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sce03021]
    YOR340C (RPA43)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase I system
   RNA polymerase I
    Pol I specific subunits
     YOR340C (RPA43)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RPA43_OB SHS2_Rpb7-N
Motif
Other DBs
NCBI-GeneID: 854518
NCBI-ProteinID: NP_014985
SGD: S000005867
UniProt: P46669
Structure
PDB: 

Position
XV:complement(959202..960182)
Genome map
AA seq 326 aa AA seqDB search
MSQVKRANENRETARFIKKHKKQVTNPIDEKNGTSNCIVRVPIALYVSLAPMYLENPLQG
VMKQHLNPLVMKYNNKVGGVVLGYEGLKILDADPLSKEDTSEKLIKITPDTPFGFTWCHV
NLYVWQPQVGDVLEGYIFIQSASHIGLLIHDAFNASIKKNNIPVDWTFVHNDVEEDADVI
NTDENNGNNNNEDNKDSNGGSNSLGKFSFGNRSLGHWVDSNGEPIDGKLRFTVRNVHTTG
RVVSVDGTLISDADEEGNGYNSSRSQAESLPIVSNKKIVFDDEVSIENKESHKELDLPEV
KEDNGSEIVYEENTSESNDGESSDSD
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaagtaaaaagagccaatgagaaccgcgaaaccgcaaggttcatcaagaaacac
aaaaaacaggttacaaacccaattgatgagaaaaatggaacttccaactgtatagtgcgt
gttcccattgctctctatgtttctttggcaccaatgtatttagaaaatcccttgcaaggt
gtcatgaagcagcacttgaacccattagtaatgaaatataacaacaaagttggaggtgtt
gtgctaggttatgaagggttgaaaattcttgatgctgatcctttaagcaaagaagataca
tcagaaaaactaataaaaatcacacccgataccccttttggatttacttggtgccatgta
aacctatacgtttggcagccacaagttggagatgttttggaaggttacattttcattcaa
tccgcctcacacattggtcttttgattcatgatgcgtttaatgctagtatcaaaaagaat
aatatccctgtggattggacctttgtccataacgacgtggaagaagatgctgacgtgata
aacacagatgaaaataatggaaacaataataacgaagataacaaggatagcaatggtgga
agcaatagtttgggcaaattttcctttggaaacagatctttgggccactgggtagattct
aatggtgaacccattgacggtaaattgaggttcacagtgagaaatgttcatactacagga
agagttgtttctgtggacggtacattaataagtgacgccgacgaagaaggcaatggctat
aacagctctcgttcccaagctgaaagtttacctatagtttcaaacaaaaaaattgtattt
gatgacgaagtttcaatcgaaaacaaagagagccacaaggaactagacttacctgaagta
aaagaagataatggttcagagatcgtatacgaggaaaacaccagtgaaagcaatgatggt
gaatcgagtgatagtgattag

DBGET integrated database retrieval system